BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0883 (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 23 2.8 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 3.7 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -2 Query: 233 CIYVKLSIAVSRNLSIREFLLRPVSPECSNKKNQTHNIIICVITDGRTSC 84 C+ K ++ +N IR LL+ V PE + K+ I C D C Sbjct: 74 CVLEKFNVMDKKNGKIRYNLLKKVIPE-AFKEIGVEMIDSCSNVDSSDKC 122 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 406 FVNVVFDLFLRANYPLMH 459 F+ +V + LRA Y L+H Sbjct: 54 FIRIVLVILLRAGYVLIH 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,023 Number of Sequences: 438 Number of extensions: 3673 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -