BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0882 (695 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ... 27 1.9 SPCC320.05 |||sulphate transporter |Schizosaccharomyces pombe|ch... 27 1.9 >SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 27.5 bits (58), Expect = 1.9 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = -1 Query: 623 IKNNKTRISVKKIFIAVRNVSKYEHYE*FITSRLQKLSKMDTISFDLILNLVTP 462 I N+K R+S ++I V KY+ + TSR+Q + +++ ++ L +L P Sbjct: 501 ITNDKGRLSKEEIDRMVSEAEKYKAEDEAETSRIQAKNHLESYAYSLRNSLDDP 554 >SPCC320.05 |||sulphate transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 667 Score = 27.5 bits (58), Expect = 1.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 638 FNFSGIKNNKTRISVKKIFIAVRNVSKYEHY 546 F FSG+K + + K+ +RN+SK Y Sbjct: 216 FGFSGVKYKGSDFPIDKLMFLIRNMSKANIY 246 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,671,387 Number of Sequences: 5004 Number of extensions: 54614 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -