BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0882 (695 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067607-3|AAF98607.1| 590|Caenorhabditis elegans Hypothetical ... 28 7.3 Z82286-8|CAB05308.2| 487|Caenorhabditis elegans Hypothetical pr... 27 9.7 >AF067607-3|AAF98607.1| 590|Caenorhabditis elegans Hypothetical protein C18H7.6 protein. Length = 590 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 179 FSLFFCFRIKSINFGRLYFMCQTFIIARHVSGIV 280 F LF+C + + FG +F F++ H +V Sbjct: 383 FQLFYCALMTGLTFGYTFFKFHDFLMVVHKDNVV 416 >Z82286-8|CAB05308.2| 487|Caenorhabditis elegans Hypothetical protein W02A2.5 protein. Length = 487 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 650 FVFRFNFSGIKNNKTRISVKKIFIAVRNVSKY 555 FVF NFSGI T+I + + FI R +KY Sbjct: 341 FVFTKNFSGIAEFNTQIIMNQAFIQ-RTFNKY 371 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,561,772 Number of Sequences: 27780 Number of extensions: 294646 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -