BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0881 (693 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P94570 Cluster: Putative uncharacterized protein ysoC; ... 34 3.8 UniRef50_A0YAR2 Cluster: Putative esterase; n=1; marine gamma pr... 33 6.6 >UniRef50_P94570 Cluster: Putative uncharacterized protein ysoC; n=1; Bacillus subtilis|Rep: Putative uncharacterized protein ysoC - Bacillus subtilis Length = 204 Score = 33.9 bits (74), Expect = 3.8 Identities = 26/87 (29%), Positives = 38/87 (43%) Frame = +3 Query: 33 SIVIVITKRHFVNDVKNMPESSVASLARRATSGKRRAAATKPSELMTPREKPR*VIFERK 212 SI + R F VK +S +S +R A +G+R S + R K FER+ Sbjct: 104 SIFLNCLTRAFFGFVKIATNASSSSFSRLAITGRRPIN----SGINPKRSKSSGSTFERR 159 Query: 213 RRTWSGAVVLHAPRPVLFVLTRSIVEC 293 A +L AP P+ F R ++ C Sbjct: 160 SSFSRSAALLSAPNPITFCAKRRLMIC 186 >UniRef50_A0YAR2 Cluster: Putative esterase; n=1; marine gamma proteobacterium HTCC2143|Rep: Putative esterase - marine gamma proteobacterium HTCC2143 Length = 571 Score = 33.1 bits (72), Expect = 6.6 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 504 SSGAQTRGIVNTGPSKRAVLHRIYHRSGNATY*EDPARNSVG 629 S+GA + G V P R ++H+ +SG T+ P +NSVG Sbjct: 243 SAGAHSVGQVMASPLSRGLIHKAIAQSGIGTHQYTPLQNSVG 284 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 632,816,756 Number of Sequences: 1657284 Number of extensions: 11921407 Number of successful extensions: 25629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25623 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54545459628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -