BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0881 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 24 5.2 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 5.2 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 9.1 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 9.1 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 9.1 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/45 (26%), Positives = 18/45 (40%) Frame = +1 Query: 538 LALAREQCFTESTTGAEMRPTEKIRRETQWALFHNTRQATHFFRT 672 +A A T T P + + + FH T +A HF R+ Sbjct: 268 IAEASRIALTNLATALSALPARSYAQRSPYPSFHRTCKAEHFGRS 312 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 129 GKRRAAATKPSELMTPREKPR*VIFERKRRT 221 G+ R + + PSE T R + R ER RRT Sbjct: 1162 GRNRRSRSAPSEADTIRRRMRRREMERLRRT 1192 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 408 SWEYVTQIFISLFPTYADSFERLYQRY 488 +++Y+T+ + L P + D F RL+ Y Sbjct: 1427 NFDYLTRDWSILGPHHLDEFVRLWSEY 1453 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 585 RSGGRFCEALLSC*GQC*QY 526 R GR+CE +C G+C ++ Sbjct: 665 RYTGRYCEKCPTCAGRCNEF 684 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 120 LGALMTRHSTPACSLR 73 LG LM HS P C+ R Sbjct: 782 LGCLMRNHSGPKCAKR 797 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,034 Number of Sequences: 2352 Number of extensions: 12251 Number of successful extensions: 61 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -