BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0879 (610 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021501-2|CAA16415.2| 356|Caenorhabditis elegans Hypothetical ... 28 4.5 AF078157-14|AAG24081.1| 348|Caenorhabditis elegans Serpentine r... 28 6.0 >AL021501-2|CAA16415.2| 356|Caenorhabditis elegans Hypothetical protein Y61B8A.2 protein. Length = 356 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 245 ISSHKGLRLPAGSLNIVLLPFH*LQFYYI 159 ++S KG+ P+ ++ ++ LPF L FY I Sbjct: 23 LASWKGVAYPSHAIQVISLPFQILAFYVI 51 >AF078157-14|AAG24081.1| 348|Caenorhabditis elegans Serpentine receptor, class h protein92 protein. Length = 348 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 260 SE*SQISSHKGLRLPAGSLNIVLLPFH*LQFYYI 159 S+ S +SS KGL + S+ +V +P H L FY I Sbjct: 18 SDDSFLSSWKGLVVVCFSIQLVSIPCHFLTFYLI 51 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,012,057 Number of Sequences: 27780 Number of extensions: 338712 Number of successful extensions: 756 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -