BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0877 (723 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0251 + 19952882-19955459,19956209-19956245,19956370-199565... 29 3.7 01_03_0107 - 12613491-12613538,12613906-12614139,12614682-126147... 28 6.5 >01_05_0251 + 19952882-19955459,19956209-19956245,19956370-19956586, 19957063-19957221,19957397-19957516,19957609-19957719 Length = 1073 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 564 VGTSTVKKCLVPYRYQNVDFLKLYLIVLPLFKRIFLRFSVSRH*TVP 704 +G + CLV + +N+ L L++ LP FKRI S + +P Sbjct: 845 MGDQYLNDCLVTFIERNIFALVLFISPLPTFKRIVRNGSTEQFSAMP 891 >01_03_0107 - 12613491-12613538,12613906-12614139,12614682-12614713, 12616021-12616176,12617972-12618159,12618242-12618324, 12618821-12618976,12620320-12621162,12621197-12621550, 12621962-12623125 Length = 1085 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/46 (21%), Positives = 23/46 (50%) Frame = +1 Query: 304 WSDVVMTTSTRLNRSKKVVLITIYCLYFFTRISNCYWVFCNISRFC 441 ++ VV++ ++L + L FF R+ + +W + N++ C Sbjct: 196 YTRVVLSADPSSGNCTVMILHLLRNLLFFARVGDTHWTWINVNELC 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,864,909 Number of Sequences: 37544 Number of extensions: 315435 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -