BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0876 (726 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0330 + 23218018-23218398 31 1.2 11_02_0060 + 7897868-7898296 29 2.8 06_03_0545 + 21983666-21986086 29 2.8 >03_05_0330 + 23218018-23218398 Length = 126 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 260 GVNAGNTYSGKTLVNDGLLTIASHTADGVTGMGSSEVTI 144 GV A +SG T DGL+ + DGV G S + T+ Sbjct: 64 GVIAARGHSGGTAAGDGLMNKVAQLMDGVDGARSGKETV 102 >11_02_0060 + 7897868-7898296 Length = 142 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 129 ARHSRINEQCRRLHADQCAQRRWLDASAAVILRQDVW 19 AR R E R D+ +RRW+D + L VW Sbjct: 28 ARRGRRQEAAARRRPDKAEKRRWVDEQVGLHLAARVW 64 >06_03_0545 + 21983666-21986086 Length = 806 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 617 PYFCHLAAICGINGALTITPV 679 P C++ +CGING TPV Sbjct: 275 PQLCNVRGVCGINGICVYTPV 295 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,189,925 Number of Sequences: 37544 Number of extensions: 468591 Number of successful extensions: 1055 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -