BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0876 (726 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF053356-3|AAC78792.1| 817|Homo sapiens ORF2 protein. 34 0.60 AK128339-1|BAC87391.1| 276|Homo sapiens protein ( Homo sapiens ... 31 5.6 >AF053356-3|AAC78792.1| 817|Homo sapiens ORF2 protein. Length = 817 Score = 33.9 bits (74), Expect = 0.60 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +1 Query: 424 PPPHREQHQCLAFLQQXQKHLR*TSPPSNSAYRYSSG 534 PPP ++Q Q AFLQQ Q L+ P S SA ++SSG Sbjct: 478 PPPQQQQQQLTAFLQQLQA-LK--PPSSRSAEKWSSG 511 >AK128339-1|BAC87391.1| 276|Homo sapiens protein ( Homo sapiens cDNA FLJ46481 fis, clone THYMU3025772. ). Length = 276 Score = 30.7 bits (66), Expect = 5.6 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 207 EAVIDQRFTAISIPCINTEWPASWVTFPSLSSPVISISTW*PGSLL 344 ++V+ ++ S P EWPA SL P+ +ST PG+ L Sbjct: 163 DSVLQSSLSSESWPIPEPEWPAQTAQLDSLKLPLSLVSTLDPGTCL 208 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,844,588 Number of Sequences: 237096 Number of extensions: 2535568 Number of successful extensions: 4272 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4272 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8567175942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -