BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0876 (726 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93379-3|CAB07590.1| 282|Caenorhabditis elegans Hypothetical pr... 29 2.6 Z83106-6|CAB05497.2| 339|Caenorhabditis elegans Hypothetical pr... 28 7.8 >Z93379-3|CAB07590.1| 282|Caenorhabditis elegans Hypothetical protein F21H7.4 protein. Length = 282 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 114 CENVERTGVCNGYFTRPHAR 173 C NV +GV NGYF++P A+ Sbjct: 117 CINVVHSGVTNGYFSQPQAQ 136 >Z83106-6|CAB05497.2| 339|Caenorhabditis elegans Hypothetical protein F22B8.7 protein. Length = 339 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -2 Query: 578 TFQYVRRHIWY-GYVNPDE*RYAEFEGGEVYLRCF*XCCR 462 T +Y R I+ G DE ++AE G+ +L CF C R Sbjct: 229 TMRYFRPSIYIEGCAAWDEDKWAEIRIGDAHLECFAPCTR 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,196,836 Number of Sequences: 27780 Number of extensions: 376534 Number of successful extensions: 886 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -