BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0872 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G5.05 |||transketolase |Schizosaccharomyces pombe|chr 2|||M... 26 4.4 SPBC1773.04 |||flavonol reductase/cinnamoyl-CoA reductase family... 26 5.9 SPAC29B12.02c |set2||histone lysine methyltransferase Set2 |Schi... 25 7.8 >SPBC2G5.05 |||transketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 685 Score = 26.2 bits (55), Expect = 4.4 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 588 HSWFSKLCRFFNRHPKRANRDPSRSVPTHSC 680 H FS++ +F HPK NRD H+C Sbjct: 44 HVLFSRIMKFNPAHPKWLNRDRFILSNGHAC 74 >SPBC1773.04 |||flavonol reductase/cinnamoyl-CoA reductase family|Schizosaccharomyces pombe|chr 2|||Manual Length = 336 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 67 TSKRANLEPSRSLPHNCLPSCADDCEGNGCIA 162 T +NLEP R PH L CE N IA Sbjct: 82 TEVHSNLEPPRKDPHELLHIAIQGCE-NALIA 112 >SPAC29B12.02c |set2||histone lysine methyltransferase Set2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 798 Score = 25.4 bits (53), Expect = 7.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +3 Query: 543 KCRTTFANDYAKFSLHSWFSKLCRFFNRHPKRANRDPSRSVPTHSCDQ 686 + R+ F NDY S H+ F K F + + +N D T + +Q Sbjct: 564 RSRSKFGNDYQSHSKHNLFRK--NSFPKRRRLSNSDTPSETTTPNNEQ 609 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,871,308 Number of Sequences: 5004 Number of extensions: 58785 Number of successful extensions: 146 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -