BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0871 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3C7.04 |||transcription factor |Schizosaccharomyces pombe|ch... 30 0.29 SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizos... 26 4.7 >SPAC3C7.04 |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 30.3 bits (65), Expect = 0.29 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 172 LLHLLVDASQLNCIMCLFYYITMSEGI*CIFYCINE 65 L+HLL + SQL+C Y T S + + +C+ E Sbjct: 573 LVHLLQNHSQLSCYSFFDYNYTFSSALVVLLHCVTE 608 >SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizosaccharomyces pombe|chr 2|||Manual Length = 1706 Score = 26.2 bits (55), Expect = 4.7 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 266 QAEGRSISPLRSHTSLKNDV*N-AAVRKQSHITTTPPSRRVST 141 +++G+S++PL S ND N A +R Q TT ++++T Sbjct: 1087 ESKGKSLAPLISSRVSTNDTTNVAGIRSQRSFTTHIDLKKLTT 1129 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,725,424 Number of Sequences: 5004 Number of extensions: 51149 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -