BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0871 (717 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0718 + 19005460-19005767,19005854-19006370 30 1.6 03_01_0306 + 2391831-2391858,2392831-2392902,2393511-2393698,239... 28 8.5 >04_03_0718 + 19005460-19005767,19005854-19006370 Length = 274 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 664 FLEITRVPDA-GNRNAARKPASQYQWLHLGEGTANANLVFKS 542 F+ + V DA GNR AA P W+ G A ANLV+ S Sbjct: 181 FVAVDWVYDAWGNRAAAAAPQEAVAWMWFGRYLAVANLVYFS 222 >03_01_0306 + 2391831-2391858,2392831-2392902,2393511-2393698, 2394143-2394203,2394306-2394368,2394396-2394474, 2394557-2394689,2394727-2394934,2398088-2398143, 2398252-2400030,2400128-2400281,2400467-2401125 Length = 1159 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 652 TRVPDAGNRNAARKPASQYQWLHLGEGTANANL 554 TRVP A N + SQ +W L + A+ NL Sbjct: 835 TRVPLASNASIVSSDVSQTEWTSLQDDVASENL 867 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,935,587 Number of Sequences: 37544 Number of extensions: 337731 Number of successful extensions: 637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -