BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0871 (717 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical... 32 0.36 AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical ... 32 0.36 AL132948-35|CAC51060.2| 887|Caenorhabditis elegans Hypothetical... 29 2.5 U80026-1|AAC25844.1| 355|Caenorhabditis elegans Fucosyl transfe... 29 4.4 U80027-14|AAC48127.1| 199|Caenorhabditis elegans Hypothetical p... 28 5.8 >AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 163 GVVVMCDCFLT--AAFYTSFFKEVWERKGEIERPSAWSSPAPRTTCP 297 G +CDC T + Y F GE P+ W+ P +T+CP Sbjct: 1027 GCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCP 1073 >AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 163 GVVVMCDCFLT--AAFYTSFFKEVWERKGEIERPSAWSSPAPRTTCP 297 G +CDC T + Y F GE P+ W+ P +T+CP Sbjct: 1027 GCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCP 1073 >AL132948-35|CAC51060.2| 887|Caenorhabditis elegans Hypothetical protein Y39B6A.47 protein. Length = 887 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +2 Query: 665 ITTEFFRKLFHPFL 706 +T E+FR+LFHPFL Sbjct: 279 VTDEYFRRLFHPFL 292 >U80026-1|AAC25844.1| 355|Caenorhabditis elegans Fucosyl transferase protein 2 protein. Length = 355 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -3 Query: 487 ISIVFFMIDVLLVARRPFSSGQVGEDIYCLKYKFEDQ 377 I I+F + V + R ++ Q+G +I C+K+K ++Q Sbjct: 22 IVIIFIIFIVNRMGPRNYNYKQIGTEINCVKHKVDEQ 58 >U80027-14|AAC48127.1| 199|Caenorhabditis elegans Hypothetical protein T28A11.19 protein. Length = 199 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -1 Query: 648 EFPTRETEMLPENQLHNINGCIWERG-LLMRILFL 547 E R PE + GC+WE G L ++LFL Sbjct: 29 ELERRRIRNCPEVTFKRMTGCVWEFGRFLKKVLFL 63 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,233,901 Number of Sequences: 27780 Number of extensions: 295300 Number of successful extensions: 578 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -