BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0869 (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0459 + 17776421-17776498,17776608-17776668,17776977-177769... 28 8.0 02_03_0012 - 13940583-13940853,13942281-13942509,13945275-139454... 28 8.0 >09_04_0459 + 17776421-17776498,17776608-17776668,17776977-17776996, 17777067-17777129 Length = 73 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 131 LHNTRWAVSSSTHLSNKKTKKFTSYMRNSI 220 L N +W+ S HLS KK S ++NS+ Sbjct: 27 LPNKKWSTMQSAHLSMKKFGVLKSELKNSL 56 >02_03_0012 - 13940583-13940853,13942281-13942509,13945275-13945476, 13945961-13946278,13947321-13947419 Length = 372 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 140 TRWAVSSSTHLSNKKTKKFTSYMRN 214 +RWA+ T + + K FT++MRN Sbjct: 58 SRWAIMQETRVEYFRGKDFTTFMRN 82 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,595,018 Number of Sequences: 37544 Number of extensions: 279917 Number of successful extensions: 345 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -