BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0867 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 6.8 AY752895-1|AAV30069.1| 95|Anopheles gambiae peroxidase 3 protein. 23 9.0 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 374 HHIYRNGSL*RISIMLNNAYRGSFTKS 454 HH+YR + + + L N Y S TK+ Sbjct: 289 HHLYRCPACGNLFVELTNFYNHSCTKA 315 >AY752895-1|AAV30069.1| 95|Anopheles gambiae peroxidase 3 protein. Length = 95 Score = 23.0 bits (47), Expect = 9.0 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 140 KILFSFNEKRINCIKMQEIIYYNNTEYPVLPPSNSCSGWLLTESS 6 ++LF +RIN + Q+I+YY +L +N S L+ E + Sbjct: 41 EVLFQ-EARRINIAQYQQIVYYEYLP-RILGRANMLSSRLIFEGT 83 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,204 Number of Sequences: 2352 Number of extensions: 11281 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -