BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0866 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12612| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_2792| Best HMM Match : Sod_Fe_N (HMM E-Value=3.5) 28 6.2 SB_48090| Best HMM Match : Phage_P2_GpE (HMM E-Value=9.6) 28 6.2 SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_12612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 9/73 (12%) Frame = +2 Query: 56 KAEHLIIKGFPEKIVKLNELLETSNFQNRNLSDVHQDLNIPIPTPPATSNN--------- 208 KAE ++ K FPE++ +L+ LL++ F + V D IPI P + +N Sbjct: 5 KAEEVVTKFFPERVTELDNLLKSGMFALNKIPKVQADSIIPISHPNSDHSNDILLKKSFL 64 Query: 209 EPNAKRQRLDSSE 247 +P K+++L +SE Sbjct: 65 QPQNKKRKLSNSE 77 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 31.5 bits (68), Expect = 0.67 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = +2 Query: 74 IKGFPEKIVKLNELLETSNFQNRNLSDVHQDLNIPIP---TPPATSNNEPNAKRQRL 235 I+ EK+ K NE +E +N LSD+ +LN I S+++PN K Q+L Sbjct: 1947 IEEMREKMRKANEEIEKILSKNSKLSDILNELNSGIENILNEETLSDSDPNVKLQKL 2003 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 31.1 bits (67), Expect = 0.89 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +1 Query: 424 DGNNFGVSIQEDTLAEIQSVESEAAAFFVKSHDISYPGLK*YPKLPN 564 DG+N V + EDTL I+ A+ F SH ++ GL Y PN Sbjct: 1918 DGSNSVVQLGEDTLLLIKDFVKGIASSFTVSHADTHLGLLIYADSPN 1964 >SB_2792| Best HMM Match : Sod_Fe_N (HMM E-Value=3.5) Length = 290 Score = 28.3 bits (60), Expect = 6.2 Identities = 24/68 (35%), Positives = 35/68 (51%) Frame = +1 Query: 244 GVIHNSTIEGTRVYVLPNGSVPCNKPLSDLIHLVKPHIRELVEDSNLLKMWISFMIPKIE 423 G + ++T EG V VL + PC LSD+I + + EL SN + WI +I Sbjct: 88 GTVCDAT-EGLCV-VLKRFAYPCR--LSDMISIFGRSVPELSMISNEVTEWIYAHHHRIT 143 Query: 424 DGNNFGVS 447 + NNF +S Sbjct: 144 EWNNFILS 151 >SB_48090| Best HMM Match : Phage_P2_GpE (HMM E-Value=9.6) Length = 176 Score = 28.3 bits (60), Expect = 6.2 Identities = 24/68 (35%), Positives = 35/68 (51%) Frame = +1 Query: 244 GVIHNSTIEGTRVYVLPNGSVPCNKPLSDLIHLVKPHIRELVEDSNLLKMWISFMIPKIE 423 G + ++T EG V VL + PC LSD+I + + EL SN + WI +I Sbjct: 88 GTVCDAT-EGLCV-VLKRFAYPCR--LSDMISIFGRSVPELSMISNEVTEWIYAHHHRIT 143 Query: 424 DGNNFGVS 447 + NNF +S Sbjct: 144 EWNNFILS 151 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 128 NFQNRNLSDVHQDLNIPIPTPPATSNNEPNAKRQRLDSSELST 256 ++ N++ D H L+ P PTPP P K+ ++ L T Sbjct: 1384 HYTNKDPVDKHNPLHNPSPTPPTALLISPLTKQAQMTRGFLET 1426 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,140,277 Number of Sequences: 59808 Number of extensions: 421761 Number of successful extensions: 1215 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1213 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -