BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0865 (684 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X77584-1|CAA54687.1| 105|Homo sapiens ATL-derived factor/thiore... 57 7e-08 X54539-1|CAA38410.1| 105|Homo sapiens thioredoxin protein. 57 7e-08 CR407665-1|CAG28593.1| 105|Homo sapiens TXN protein. 57 7e-08 BC054866-1|AAH54866.1| 105|Homo sapiens thioredoxin protein. 57 7e-08 BC003377-1|AAH03377.1| 105|Homo sapiens thioredoxin protein. 57 7e-08 AY004872-1|AAF87085.1| 105|Homo sapiens thioredoxin protein. 57 7e-08 AL158158-1|CAI14066.1| 105|Homo sapiens thioredoxin protein. 57 7e-08 AF548001-1|AAN33187.1| 105|Homo sapiens thioredoxin protein. 57 7e-08 AF313911-1|AAG34699.1| 105|Homo sapiens thioredoxin protein. 57 7e-08 J04026-1|AAA74596.1| 105|Homo sapiens thioredoxin protein. 54 4e-07 AF276919-1|AAF86466.1| 105|Homo sapiens thioredoxin 1 protein. 54 4e-07 AL158158-2|CAI14067.1| 85|Homo sapiens thioredoxin protein. 43 0.001 AF065241-1|AAC17430.1| 84|Homo sapiens thioredoxin delta 3 pro... 43 0.001 BC014372-1|AAH14372.2| 289|Homo sapiens TXNL2 protein protein. 42 0.002 BC005289-1|AAH05289.1| 335|Homo sapiens thioredoxin-like 2 prot... 42 0.002 AL139123-3|CAC40691.1| 335|Homo sapiens thioredoxin-like 3 prot... 42 0.002 AJ010841-1|CAA09375.1| 335|Homo sapiens thioredoxin-like protei... 42 0.002 AF118652-1|AAF28844.1| 335|Homo sapiens PKCq-interacting protei... 42 0.002 AF118649-1|AAF28841.1| 335|Homo sapiens PKCq-interacting protei... 42 0.002 U78678-1|AAB41631.1| 166|Homo sapiens thioredoxin protein. 42 0.003 CR541917-1|CAG46715.1| 166|Homo sapiens TXN2 protein. 42 0.003 CR541896-1|CAG46694.1| 166|Homo sapiens TXN2 protein. 42 0.003 CR456601-1|CAG30487.1| 166|Homo sapiens TXN2 protein. 42 0.003 BC050610-1|AAH50610.1| 166|Homo sapiens thioredoxin 2 protein. 42 0.003 BC013726-1|AAH13726.1| 166|Homo sapiens thioredoxin 2 protein. 42 0.003 BC001156-1|AAH01156.1| 289|Homo sapiens thioredoxin-like 1 prot... 42 0.003 AL022313-1|CAI19226.1| 197|Homo sapiens thioredoxin 2 protein. 42 0.003 AF480262-1|AAN05576.1| 166|Homo sapiens mitochondrial thioredox... 42 0.003 AF276920-1|AAF86467.1| 166|Homo sapiens thioredoxin 2 protein. 42 0.003 AF143897-1|AAF66676.1| 289|Homo sapiens thioredoxin-like protei... 42 0.003 AF052659-1|AAC39898.1| 289|Homo sapiens thioredoxin-related pro... 42 0.003 AF051896-1|AAC05830.1| 289|Homo sapiens thioredoxin homolog pro... 42 0.003 AF003938-1|AAC39599.1| 289|Homo sapiens thioredoxin-like protei... 42 0.003 AB209263-1|BAD92500.1| 280|Homo sapiens thioredoxin-like 1 vari... 42 0.003 EF560747-1|ABQ59057.1| 538|Homo sapiens TXNDC2 protein protein. 40 0.006 BC050132-1|AAH50132.1| 486|Homo sapiens thioredoxin domain cont... 40 0.006 AK097656-1|BAC05133.1| 553|Homo sapiens protein ( Homo sapiens ... 40 0.006 AF080095-1|AAK94950.1| 486|Homo sapiens sperm-specific thioredo... 40 0.006 BC052310-1|AAH52310.1| 360|Homo sapiens TXNDC5 protein protein. 32 2.2 BC001199-1|AAH01199.1| 324|Homo sapiens TXNDC5 protein protein. 32 2.2 AY358646-1|AAQ89009.1| 432|Homo sapiens disulfide isomerase pro... 32 2.2 AY326464-1|AAR99514.1| 363|Homo sapiens putative protein STRF8 ... 32 2.2 AL834423-1|CAD39084.1| 244|Homo sapiens hypothetical protein pr... 32 2.2 AL133541-2|CAI19473.1| 432|Homo sapiens thioredoxin domain cont... 32 2.2 AK075291-1|BAC11526.1| 432|Homo sapiens protein ( Homo sapiens ... 32 2.2 AJ440721-1|CAD29430.1| 363|Homo sapiens thioredoxin related pro... 32 2.2 X05130-1|CAA28775.1| 508|Homo sapiens protein ( Human mRNA for ... 31 3.8 M22806-1|AAC13652.1| 508|Homo sapiens prolyl 4-hydroxylase beta... 31 3.8 J02783-1|AAA61169.1| 508|Homo sapiens P4HB protein. 31 3.8 BC071892-1|AAH71892.1| 508|Homo sapiens procollagen-proline, 2-... 31 3.8 BC029617-1|AAH29617.1| 508|Homo sapiens procollagen-proline, 2-... 31 3.8 BC010859-1|AAH10859.1| 508|Homo sapiens procollagen-proline, 2-... 31 3.8 BC005374-1|AAH05374.1| 406|Homo sapiens thioredoxin domain cont... 30 6.7 AY359048-1|AAQ89407.1| 406|Homo sapiens TXNDC4 protein. 30 6.7 AL360084-2|CAH70308.1| 406|Homo sapiens thioredoxin domain cont... 30 6.7 AL358937-2|CAI95319.1| 406|Homo sapiens thioredoxin domain cont... 30 6.7 AL137072-1|CAH72172.1| 406|Homo sapiens thioredoxin domain cont... 30 6.7 AJ344330-1|CAC87611.1| 406|Homo sapiens ERp44 protein protein. 30 6.7 AB011145-1|BAA25499.1| 451|Homo sapiens KIAA0573 protein protein. 30 6.7 >X77584-1|CAA54687.1| 105|Homo sapiens ATL-derived factor/thioredoxin protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >X54539-1|CAA38410.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >CR407665-1|CAG28593.1| 105|Homo sapiens TXN protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >BC054866-1|AAH54866.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >BC003377-1|AAH03377.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >AY004872-1|AAF87085.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >AL158158-1|CAI14066.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >AF548001-1|AAN33187.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >AF313911-1|AAG34699.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 56.8 bits (131), Expect = 7e-08 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGAN 93 >J04026-1|AAA74596.1| 105|Homo sapiens thioredoxin protein. Length = 105 Score = 54.4 bits (125), Expect = 4e-07 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + PTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGAN 93 >AF276919-1|AAF86466.1| 105|Homo sapiens thioredoxin 1 protein. Length = 105 Score = 54.4 bits (125), Expect = 4e-07 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDVD+C+D+ASE + PTF F K G+K+ EFSGAN Sbjct: 55 LEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGAN 93 >AL158158-2|CAI14067.1| 85|Homo sapiens thioredoxin protein. Length = 85 Score = 42.7 bits (96), Expect = 0.001 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +3 Query: 36 DIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 44 DVASECEVKCMPTFQFFKKGQKVGEFSGAN 73 >AF065241-1|AAC17430.1| 84|Homo sapiens thioredoxin delta 3 protein. Length = 84 Score = 42.7 bits (96), Expect = 0.001 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +3 Query: 36 DIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 D+ASE + MPTF F K G+K+ EFSGAN Sbjct: 43 DVASECEVKCMPTFQFFKKGQKVGEFSGAN 72 >BC014372-1|AAH14372.2| 289|Homo sapiens TXNL2 protein protein. Length = 289 Score = 41.9 bits (94), Expect = 0.002 Identities = 15/39 (38%), Positives = 28/39 (71%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 VK++ + +++ +Y I+S+PTF+F KN +K+D GA+ Sbjct: 20 VKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAH 58 >BC005289-1|AAH05289.1| 335|Homo sapiens thioredoxin-like 2 protein. Length = 335 Score = 41.9 bits (94), Expect = 0.002 Identities = 15/39 (38%), Positives = 28/39 (71%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 VK++ + +++ +Y I+S+PTF+F KN +K+D GA+ Sbjct: 66 VKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAH 104 >AL139123-3|CAC40691.1| 335|Homo sapiens thioredoxin-like 3 protein. Length = 335 Score = 41.9 bits (94), Expect = 0.002 Identities = 15/39 (38%), Positives = 28/39 (71%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 VK++ + +++ +Y I+S+PTF+F KN +K+D GA+ Sbjct: 66 VKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAH 104 >AJ010841-1|CAA09375.1| 335|Homo sapiens thioredoxin-like protein protein. Length = 335 Score = 41.9 bits (94), Expect = 0.002 Identities = 15/39 (38%), Positives = 28/39 (71%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 VK++ + +++ +Y I+S+PTF+F KN +K+D GA+ Sbjct: 66 VKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAH 104 >AF118652-1|AAF28844.1| 335|Homo sapiens PKCq-interacting protein PICOT protein. Length = 335 Score = 41.9 bits (94), Expect = 0.002 Identities = 15/39 (38%), Positives = 28/39 (71%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 VK++ + +++ +Y I+S+PTF+F KN +K+D GA+ Sbjct: 66 VKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAH 104 >AF118649-1|AAF28841.1| 335|Homo sapiens PKCq-interacting protein PICOT protein. Length = 335 Score = 41.9 bits (94), Expect = 0.002 Identities = 15/39 (38%), Positives = 28/39 (71%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 VK++ + +++ +Y I+S+PTF+F KN +K+D GA+ Sbjct: 66 VKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAH 104 >U78678-1|AAB41631.1| 166|Homo sapiens thioredoxin protein. Length = 166 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 115 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 150 >CR541917-1|CAG46715.1| 166|Homo sapiens TXN2 protein. Length = 166 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 115 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 150 >CR541896-1|CAG46694.1| 166|Homo sapiens TXN2 protein. Length = 166 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 115 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 150 >CR456601-1|CAG30487.1| 166|Homo sapiens TXN2 protein. Length = 166 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 115 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 150 >BC050610-1|AAH50610.1| 166|Homo sapiens thioredoxin 2 protein. Length = 166 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 115 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 150 >BC013726-1|AAH13726.1| 166|Homo sapiens thioredoxin 2 protein. Length = 166 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 115 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 150 >BC001156-1|AAH01156.1| 289|Homo sapiens thioredoxin-like 1 protein. Length = 289 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/39 (38%), Positives = 29/39 (74%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDV +C+ A+ NI++ PTF+F +N ++D++ GA+ Sbjct: 57 LEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGAD 95 >AL022313-1|CAI19226.1| 197|Homo sapiens thioredoxin 2 protein. Length = 197 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 146 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 181 >AF480262-1|AAN05576.1| 166|Homo sapiens mitochondrial thioredoxin protein. Length = 166 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 115 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 150 >AF276920-1|AAF86467.1| 166|Homo sapiens thioredoxin 2 protein. Length = 166 Score = 41.5 bits (93), Expect = 0.003 Identities = 16/36 (44%), Positives = 27/36 (75%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD+D+ D+A EY ++++PT + +KNG +D+F G Sbjct: 115 KVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG 150 >AF143897-1|AAF66676.1| 289|Homo sapiens thioredoxin-like protein protein. Length = 289 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/39 (38%), Positives = 29/39 (74%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDV +C+ A+ NI++ PTF+F +N ++D++ GA+ Sbjct: 57 LEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGAD 95 >AF052659-1|AAC39898.1| 289|Homo sapiens thioredoxin-related protein protein. Length = 289 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/39 (38%), Positives = 29/39 (74%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDV +C+ A+ NI++ PTF+F +N ++D++ GA+ Sbjct: 57 LEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGAD 95 >AF051896-1|AAC05830.1| 289|Homo sapiens thioredoxin homolog protein. Length = 289 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/39 (38%), Positives = 29/39 (74%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDV +C+ A+ NI++ PTF+F +N ++D++ GA+ Sbjct: 57 LEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGAD 95 >AF003938-1|AAC39599.1| 289|Homo sapiens thioredoxin-like protein protein. Length = 289 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/39 (38%), Positives = 29/39 (74%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDV +C+ A+ NI++ PTF+F +N ++D++ GA+ Sbjct: 57 LEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGAD 95 >AB209263-1|BAD92500.1| 280|Homo sapiens thioredoxin-like 1 variant protein. Length = 280 Score = 41.5 bits (93), Expect = 0.003 Identities = 15/39 (38%), Positives = 29/39 (74%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 125 ++VDV +C+ A+ NI++ PTF+F +N ++D++ GA+ Sbjct: 52 LEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGAD 90 >EF560747-1|ABQ59057.1| 538|Homo sapiens TXNDC2 protein protein. Length = 538 Score = 40.3 bits (90), Expect = 0.006 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 122 ++VD D CE++ E I +PTF F K +K+DE GA Sbjct: 488 LEVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGA 525 >BC050132-1|AAH50132.1| 486|Homo sapiens thioredoxin domain containing 2 (spermatozoa) protein. Length = 486 Score = 40.3 bits (90), Expect = 0.006 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 122 ++VD D CE++ E I +PTF F K +K+DE GA Sbjct: 436 LEVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGA 473 >AK097656-1|BAC05133.1| 553|Homo sapiens protein ( Homo sapiens cDNA FLJ40337 fis, clone TESTI2032044, moderately similar to THIOREDOXIN. ). Length = 553 Score = 40.3 bits (90), Expect = 0.006 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 122 ++VD D CE++ E I +PTF F K +K+DE GA Sbjct: 503 LEVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGA 540 >AF080095-1|AAK94950.1| 486|Homo sapiens sperm-specific thioredoxin protein. Length = 486 Score = 40.3 bits (90), Expect = 0.006 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +3 Query: 9 VKVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 122 ++VD D CE++ E I +PTF F K +K+DE GA Sbjct: 436 LEVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGA 473 >BC052310-1|AAH52310.1| 360|Homo sapiens TXNDC5 protein protein. Length = 360 Score = 31.9 bits (69), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 +VD +I S+Y++ PT + + GKK+ E SG Sbjct: 306 EVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSG 341 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD + ++ S + PT ++ ++GKK+D++ G Sbjct: 172 KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKG 207 >BC001199-1|AAH01199.1| 324|Homo sapiens TXNDC5 protein protein. Length = 324 Score = 31.9 bits (69), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 +VD +I S+Y++ PT + + GKK+ E SG Sbjct: 270 EVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSG 305 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD + ++ S + PT ++ ++GKK+D++ G Sbjct: 136 KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKG 171 >AY358646-1|AAQ89009.1| 432|Homo sapiens disulfide isomerase protein. Length = 432 Score = 31.9 bits (69), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 +VD +I S+Y++ PT + + GKK+ E SG Sbjct: 378 EVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSG 413 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD + ++ S + PT ++ ++GKK+D++ G Sbjct: 244 KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKG 279 >AY326464-1|AAR99514.1| 363|Homo sapiens putative protein STRF8 protein. Length = 363 Score = 31.9 bits (69), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 +VD +I S+Y++ PT + + GKK+ E SG Sbjct: 309 EVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSG 344 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD + ++ S + PT ++ ++GKK+D++ G Sbjct: 175 KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKG 210 >AL834423-1|CAD39084.1| 244|Homo sapiens hypothetical protein protein. Length = 244 Score = 31.9 bits (69), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 +VD +I S+Y++ PT + + GKK+ E SG Sbjct: 190 EVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSG 225 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD + ++ S + PT ++ ++GKK+D++ G Sbjct: 56 KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKG 91 >AL133541-2|CAI19473.1| 432|Homo sapiens thioredoxin domain containing 5 protein. Length = 432 Score = 31.9 bits (69), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 +VD +I S+Y++ PT + + GKK+ E SG Sbjct: 378 EVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSG 413 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD + ++ S + PT ++ ++GKK+D++ G Sbjct: 244 KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKG 279 >AK075291-1|BAC11526.1| 432|Homo sapiens protein ( Homo sapiens cDNA FLJ90810 fis, clone Y79AA1000876, weakly similar to PROTEIN DISULFIDE ISOMERASE-RELATED PROTEIN PRECURSOR. ). Length = 432 Score = 31.9 bits (69), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 +VD +I S+Y++ PT + + GKK+ E SG Sbjct: 378 EVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSG 413 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD + ++ S + PT ++ ++GKK+D++ G Sbjct: 244 KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKG 279 >AJ440721-1|CAD29430.1| 363|Homo sapiens thioredoxin related protein protein. Length = 363 Score = 31.9 bits (69), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 +VD +I S+Y++ PT + + GKK+ E SG Sbjct: 309 EVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSG 344 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLDEFSG 119 KVD + ++ S + PT ++ ++GKK+D++ G Sbjct: 175 KVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKG 210 >X05130-1|CAA28775.1| 508|Homo sapiens protein ( Human mRNA for prolyl 4-hydoxylase beta subunit (EC 1.14.11.2) (procollagen-L-proline, 2-oxoglutarate:oxygen oxidoreductase, 4-hydroxylating). ). Length = 508 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNG 95 KVD E D+A +Y + PT F +NG Sbjct: 81 KVDATEESDLAQQYGVRGYPTIKFFRNG 108 >M22806-1|AAC13652.1| 508|Homo sapiens prolyl 4-hydroxylase beta-subunit protein. Length = 508 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNG 95 KVD E D+A +Y + PT F +NG Sbjct: 81 KVDATEESDLAQQYGVRGYPTIKFFRNG 108 >J02783-1|AAA61169.1| 508|Homo sapiens P4HB protein. Length = 508 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNG 95 KVD E D+A +Y + PT F +NG Sbjct: 81 KVDATEESDLAQQYGVRGYPTIKFFRNG 108 >BC071892-1|AAH71892.1| 508|Homo sapiens procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta protein. Length = 508 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNG 95 KVD E D+A +Y + PT F +NG Sbjct: 81 KVDATEESDLAQQYGVRGYPTIKFFRNG 108 >BC029617-1|AAH29617.1| 508|Homo sapiens procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta protein. Length = 508 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNG 95 KVD E D+A +Y + PT F +NG Sbjct: 81 KVDATEESDLAQQYGVRGYPTIKFFRNG 108 >BC010859-1|AAH10859.1| 508|Homo sapiens procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta protein. Length = 508 Score = 31.1 bits (67), Expect = 3.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNG 95 KVD E D+A +Y + PT F +NG Sbjct: 81 KVDATEESDLAQQYGVRGYPTIKFFRNG 108 >BC005374-1|AAH05374.1| 406|Homo sapiens thioredoxin domain containing 4 (endoplasmic reticulum) protein. Length = 406 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLD-EFSG 119 +VD D+ DIA Y I+ PT +NG + E+ G Sbjct: 89 RVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRG 125 >AY359048-1|AAQ89407.1| 406|Homo sapiens TXNDC4 protein. Length = 406 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLD-EFSG 119 +VD D+ DIA Y I+ PT +NG + E+ G Sbjct: 89 RVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRG 125 >AL360084-2|CAH70308.1| 406|Homo sapiens thioredoxin domain containing 4 (endoplasmic reticulum) protein. Length = 406 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLD-EFSG 119 +VD D+ DIA Y I+ PT +NG + E+ G Sbjct: 89 RVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRG 125 >AL358937-2|CAI95319.1| 406|Homo sapiens thioredoxin domain containing 4 (endoplasmic reticulum) protein. Length = 406 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLD-EFSG 119 +VD D+ DIA Y I+ PT +NG + E+ G Sbjct: 89 RVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRG 125 >AL137072-1|CAH72172.1| 406|Homo sapiens thioredoxin domain containing 4 (endoplasmic reticulum) protein. Length = 406 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLD-EFSG 119 +VD D+ DIA Y I+ PT +NG + E+ G Sbjct: 89 RVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRG 125 >AJ344330-1|CAC87611.1| 406|Homo sapiens ERp44 protein protein. Length = 406 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLD-EFSG 119 +VD D+ DIA Y I+ PT +NG + E+ G Sbjct: 89 RVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRG 125 >AB011145-1|BAA25499.1| 451|Homo sapiens KIAA0573 protein protein. Length = 451 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 12 KVDVDECEDIASEYNINSMPTFVFVKNGKKLD-EFSG 119 +VD D+ DIA Y I+ PT +NG + E+ G Sbjct: 134 RVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRG 170 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,545,578 Number of Sequences: 237096 Number of extensions: 1575319 Number of successful extensions: 2361 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 2284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2361 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -