Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0864
         (692 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0697 - 5389071-5389487,5390301-5390390,5390472-5390536,539...    28   8.1  

>01_01_0697 -
           5389071-5389487,5390301-5390390,5390472-5390536,
           5391106-5391176,5391297-5391335,5392938-5393350
          Length = 364

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = -2

Query: 652 CRRGSSCVDFVGHGNPLTFL-YLPTKNVVWEQVKFHLVKIVLEHSIMSTLFILECVQRHV 476
           C  G   +D++GHG       Y+P+ + V E +   L KIVLE+  +    +       V
Sbjct: 164 CGFGVYAMDWIGHGGSDGLHGYVPSLDYVVEDIDVLLGKIVLENPGVPCFLLGHSTGGAV 223

Query: 475 VTKA 464
           V KA
Sbjct: 224 VLKA 227


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,715,823
Number of Sequences: 37544
Number of extensions: 347073
Number of successful extensions: 614
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 610
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 614
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1768474200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)