BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0863 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 28 1.5 SPAC25B8.13c |isp7||2-OG-Fe|Schizosaccharomyces pombe|chr 1|||Ma... 27 1.9 SPBC725.07 |pex5||peroxisomal targeting signal receptor |Schizos... 27 2.5 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +1 Query: 583 SESQTLYWPGISK*TWFVTFHIILFLLDYVFYFPF 687 S++ + W I+ T F+ FH++LF+L YV +PF Sbjct: 5 SQNTSFVWVVIA--TGFL-FHLVLFVLSYVLGWPF 36 >SPAC25B8.13c |isp7||2-OG-Fe|Schizosaccharomyces pombe|chr 1|||Manual Length = 397 Score = 27.5 bits (58), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 441 NSARDRYTVPWGFNGFINYI 382 NS DRYT+P+ G I+Y+ Sbjct: 339 NSGSDRYTIPFFLQGNIDYV 358 >SPBC725.07 |pex5||peroxisomal targeting signal receptor |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 242 AISIAYQFYLRVTSSATSEDINLDYFSNKAK 334 A+S+ Q Y+RV S+ +INL YF + AK Sbjct: 498 AVSLQPQ-YVRVRSNMAVSNINLGYFEDAAK 527 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,661,820 Number of Sequences: 5004 Number of extensions: 51695 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -