Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0863
         (688 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p...    25   3.0  
AY805323-1|AAV66543.1|  459|Anopheles gambiae beta subunit-GABA-...    24   3.9  

>AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein
           protein.
          Length = 1077

 Score = 24.6 bits (51), Expect = 3.0
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = -3

Query: 227 LLSPKIKHMCNKLIKYWGVIAR*HSCSIKP 138
           LLS  IK   + +I  WG+I+    C  KP
Sbjct: 531 LLSKVIKPRLDCIIGKWGIISTAQKCCNKP 560


>AY805323-1|AAV66543.1|  459|Anopheles gambiae beta
           subunit-GABA-A-gated chloride channelprotein.
          Length = 459

 Score = 24.2 bits (50), Expect = 3.9
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = +2

Query: 659 YLIMCFIFLF 688
           YL+MCF+F+F
Sbjct: 288 YLVMCFVFVF 297


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 680,443
Number of Sequences: 2352
Number of extensions: 14146
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 69413730
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)