BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0863 (688 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-2496|AAF53395.3| 678|Drosophila melanogaster CG4220-PA... 31 2.0 AE014134-2494|AAO41196.1| 818|Drosophila melanogaster CG4220-PB... 31 2.0 >AE014134-2496|AAF53395.3| 678|Drosophila melanogaster CG4220-PA, isoform A protein. Length = 678 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 175 PQYLINLLHICFIFGDRREHFFCDFYRISVLFARHILRN 291 PQ L+ L + I+G RR F+C YR+S L+ + L N Sbjct: 95 PQRLLLLFLLAIIYGMRRNGFYCK-YRVSCLWHKTQLDN 132 >AE014134-2494|AAO41196.1| 818|Drosophila melanogaster CG4220-PB, isoform B protein. Length = 818 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 175 PQYLINLLHICFIFGDRREHFFCDFYRISVLFARHILRN 291 PQ L+ L + I+G RR F+C YR+S L+ + L N Sbjct: 95 PQRLLLLFLLAIIYGMRRNGFYCK-YRVSCLWHKTQLDN 132 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,471,088 Number of Sequences: 53049 Number of extensions: 544499 Number of successful extensions: 931 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 3013199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -