BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0861 (446 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 25 0.25 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 25 0.25 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 3.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 5.3 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 20 9.3 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 25.4 bits (53), Expect = 0.25 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 289 CSLAFAILFVLLDFDYN 239 C AF+ LF++L FD N Sbjct: 358 CGSAFSYLFIMLQFDLN 374 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 25.4 bits (53), Expect = 0.25 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 289 CSLAFAILFVLLDFDYN 239 C AF+ LF++L FD N Sbjct: 343 CGSAFSYLFIMLQFDLN 359 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 3.0 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -2 Query: 337 EGLTGFPNPIVNFI---VGCSLAFAILFVLLDF 248 E L N VNF G +AF I F LDF Sbjct: 201 ETLAQILNQTVNFYNSAFGWPIAFLIFFATLDF 233 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 5.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 188 SLMINSFINGGISIEFGNMTSA 123 S M+NS + GG+++ MTS+ Sbjct: 51 SSMLNSGMPGGMAMNGNGMTSS 72 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = +3 Query: 252 SNRTNKIAKANEQPTIKFTMGLGKPVSPSLYD 347 +NR N++ + E ++ M G +PS ++ Sbjct: 82 TNRKNRVLQWREPEELRRLMDFGVRSAPSTHE 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,760 Number of Sequences: 336 Number of extensions: 2113 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10090848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -