BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0861 (446 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 >SB_21191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 541 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +1 Query: 85 TRLLESINTIGNKADVILPNSIEMPPLMKLFIIKDHEKKGLETSKDFM 228 T L + + IG DVI +EM K+FI +D GL +K M Sbjct: 94 TSLANANDLIGALKDVIHETKVEMCKPGKVFIARDTRPSGLAFTKALM 141 >SB_2459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1741 Score = 27.5 bits (58), Expect = 5.3 Identities = 30/88 (34%), Positives = 43/88 (48%) Frame = +1 Query: 4 HEKLPNITEIYRTSYKTDYQLIPKREETRLLESINTIGNKADVILPNSIEMPPLMKLFII 183 H N T I++ SYKTDY L KR LE++ TI NK L + ++ F Sbjct: 610 HSNDDNKTTIFQ-SYKTDYSLKVKR-----LEAVLTI-NKVKTSLEGEYSI-KIVGGFNG 661 Query: 184 KDHEKKGLETSKDFMMPLSYNQSPIEQT 267 ++ +G TS ++PLS SP +T Sbjct: 662 TTYQSRG--TSLKVLVPLSIT-SPANKT 686 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,948,795 Number of Sequences: 59808 Number of extensions: 211473 Number of successful extensions: 361 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -