BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0860 (660 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF134186-1|AAD55361.1| 1359|Caenorhabditis elegans XNP-1 protein. 29 2.9 AF000196-11|AAC24256.1| 1359|Caenorhabditis elegans Human xnp ge... 29 2.9 Z68302-4|CAB54515.1| 521|Caenorhabditis elegans Hypothetical pr... 28 6.8 >AF134186-1|AAD55361.1| 1359|Caenorhabditis elegans XNP-1 protein. Length = 1359 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 221 REVQRHLLSDSETHDTQLMWNILDNYRDVVSDIKALQRWHA 343 +E Q+ L+ + E DT + N LD+Y+ + +AL+ WH+ Sbjct: 540 KEFQKWLVDNDEELDT-IDVNELDSYKTIEDRRRALKAWHS 579 >AF000196-11|AAC24256.1| 1359|Caenorhabditis elegans Human xnp gene related protein 1 protein. Length = 1359 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 221 REVQRHLLSDSETHDTQLMWNILDNYRDVVSDIKALQRWHA 343 +E Q+ L+ + E DT + N LD+Y+ + +AL+ WH+ Sbjct: 540 KEFQKWLVDNDEELDT-IDVNELDSYKTIEDRRRALKAWHS 579 >Z68302-4|CAB54515.1| 521|Caenorhabditis elegans Hypothetical protein ZK792.8 protein. Length = 521 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 249 SDNRWRCTSRAF*MLLDPSIFVRLFGDRWRYSYR 148 +D W C R M++ +I V FG WR++ R Sbjct: 197 TDCGWGCMIRTTQMMVAQAIMVNRFGRDWRFTRR 230 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,920,746 Number of Sequences: 27780 Number of extensions: 273860 Number of successful extensions: 640 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -