BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0858 (600 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0039 - 319871-319914,320021-320084,320198-320263,320397-32... 39 0.003 11_01_0040 - 304439-304482,304589-304652,304766-304831,305509-30... 33 0.17 03_05_0650 - 26423829-26424179,26424379-26424612,26424961-264252... 31 0.93 03_06_0766 - 36106116-36106230,36106598-36106716,36106880-361069... 29 2.2 10_08_0433 - 17889072-17889632,17890437-17890514,17892196-17892393 28 5.0 03_02_0471 + 8734292-8734788,8735168-8735654,8735766-8736551 28 5.0 04_04_1528 + 34172149-34172233,34172335-34172414,34172621-341726... 28 6.6 12_02_0911 + 24236374-24237582 27 8.7 03_02_0316 - 7408003-7409340 27 8.7 >12_01_0039 - 319871-319914,320021-320084,320198-320263,320397-320458, 321211-321298,321401-321461,321542-321625,322332-322630 Length = 255 Score = 39.1 bits (87), Expect = 0.003 Identities = 25/78 (32%), Positives = 42/78 (53%) Frame = +1 Query: 1 ALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKGQRDLAGKASTLKK 180 A+E AL LE V + + + S ND L D++ EFL+EQ + + ++ + L++ Sbjct: 178 AMELALALEKLVNEKLHN-LHSVASRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRR 236 Query: 181 MMDKHAALGEFIFDKKLL 234 + H G + FD+KLL Sbjct: 237 VGKGH---GVWHFDQKLL 251 >11_01_0040 - 304439-304482,304589-304652,304766-304831,305509-305640, 305744-305804,305885-306018,306310-306654 Length = 281 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = +1 Query: 73 SSFNDYHLVDYLSGEFLDEQYKGQRDLAGKASTLKKMMDKHAALGEFIFDKKLL 234 S ND L D++ EFL+EQ + + ++ + L+++ H G + FD+KLL Sbjct: 227 SRCNDPQLTDFVESEFLEEQVEAIKKISEYVAQLRRVGKGH---GVWHFDQKLL 277 >03_05_0650 - 26423829-26424179,26424379-26424612,26424961-26425236, 26425372-26425648,26425751-26425764,26425843-26425989, 26426306-26426366,26426570-26426604,26426688-26426882, 26428230-26428439,26428865-26428940,26429519-26429799 Length = 718 Score = 30.7 bits (66), Expect = 0.93 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +1 Query: 10 HALKLESDVTNSIREVIK-TCESSFNDYHLVDYLSGEFLDEQYKGQRDLAGKASTLKK 180 H L V S +E I T ES F YH+ YLS + + + K Q+ + G KK Sbjct: 141 HFTVLVRGVPKSTKESISCTVESFFTKYHVSSYLSHQIIYKVGKLQKIVTGAKKAYKK 198 >03_06_0766 - 36106116-36106230,36106598-36106716,36106880-36106960, 36107062-36107118,36107350-36107373,36107810-36107909, 36107983-36108053,36108132-36108236,36108674-36108847, 36109406-36109555,36109701-36109871,36109968-36110024, 36110107-36110142,36110165-36110357,36110439-36110578, 36110960-36111166,36111442-36111498,36111711-36111809, 36112289-36112408,36112865-36113032,36113450-36113510, 36113611-36113720,36114132-36114263,36114344-36114511, 36115118-36115182,36115242-36115372,36115450-36115487, 36116272-36116373,36116480-36116537,36117479-36117580, 36117695-36117909,36118158-36118307,36118699-36118858, 36118984-36119042,36119287-36119443,36119536-36119681, 36121376-36121648,36122889-36122891 Length = 1457 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/64 (25%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = +1 Query: 43 SIREVIKTCESSFNDYHLVDYLSGEFLDEQYKGQRDLAGKASTLKKMM-DKHAALGEFIF 219 S++++ K C ++D + + +S E L+E TLK +M +K A+ G F+ Sbjct: 1356 SVQQLYKICTQYWDDKYNTESVSEEVLNEMKTLMNGKDASDGTLKSLMNEKDASDGTFLL 1415 Query: 220 DKKL 231 ++++ Sbjct: 1416 NEEI 1419 >10_08_0433 - 17889072-17889632,17890437-17890514,17892196-17892393 Length = 278 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 90 PPGRLFVRGIPRRTVQGPTRPRRQG-LDPQEDDGQTRRPRRVHL 218 PPG VR P++ Q P PRR+ P R P R HL Sbjct: 118 PPGFAGVRQPPQKQQQLPPPPRRRAQQQPASAAAHHRNPNRHHL 161 >03_02_0471 + 8734292-8734788,8735168-8735654,8735766-8736551 Length = 589 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 28 SDVTNSIREVIKTCESSFNDYHLV 99 +D+TN+ E I T SS ND+ LV Sbjct: 393 TDITNAALEAIGTYSSSLNDFRLV 416 >04_04_1528 + 34172149-34172233,34172335-34172414,34172621-34172689, 34172780-34172837,34173296-34173357,34173441-34173554, 34173862-34173964,34174085-34174134,34174335-34174724, 34174918-34175244,34175360-34175689 Length = 555 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 64 TCESSFNDYHLVDYLSGEFLDEQY-KGQRDLAGKASTL-KKMMDKHAALGEFI 216 TC+SSFND + + ++G E + K Q DL + + KK D+ + EF+ Sbjct: 401 TCDSSFNDKPIRETVAGPLGKELFEKEQEDLLSDLNDIPKKACDRR--INEFV 451 >12_02_0911 + 24236374-24237582 Length = 402 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 16 LKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYKGQRDL 153 L+L+ S +EV +H+ D+LS +EQY G L Sbjct: 181 LQLQQQTPASCQEVFVRSHGEEYGFHVDDFLSDACSNEQYSGDSSL 226 >03_02_0316 - 7408003-7409340 Length = 445 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 160 KASTLKKMMDKHAALGEFIFDKKLLGLN 243 KA+ L KM++KH LGE + GLN Sbjct: 415 KATELLKMLNKHKGLGECVDAVDFRGLN 442 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,701,569 Number of Sequences: 37544 Number of extensions: 264083 Number of successful extensions: 572 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -