BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0854 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 24 1.2 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 24 1.2 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.8 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.8 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 3.6 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 3.6 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 3.6 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 3.6 AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 23 3.6 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 4.8 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -2 Query: 540 IFCIPEAANTKINIFKFITDVKNIFYSFIKNVYM 439 +F I + +K+ I+K+ + +I ++ K V+M Sbjct: 80 MFLISQQKTSKLKIYKWNNQILHILWTSYKKVFM 113 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -2 Query: 540 IFCIPEAANTKINIFKFITDVKNIFYSFIKNVYM 439 +F I + +K+ I+K+ + +I ++ K V+M Sbjct: 63 MFLISQQKTSKLKIYKWNNQILHILWTSYKKVFM 96 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 388 LVSIYLCLRIVVLSLSTLAPE 326 LVSI +C+ +VVL++ +P+ Sbjct: 317 LVSISICVTVVVLNVHFRSPQ 337 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 388 LVSIYLCLRIVVLSLSTLAPE 326 LVSI +C+ +VVL++ +P+ Sbjct: 317 LVSISICVTVVVLNVHFRSPQ 337 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +2 Query: 557 SNNSINKTRY*LII----YNPKLYFYFGFFYQVVAKGTLMYG 670 SNN+I+ Y YN KLY+ + Q+ + YG Sbjct: 86 SNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYYG 127 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +2 Query: 557 SNNSINKTRY*LII----YNPKLYFYFGFFYQVVAKGTLMYG 670 SNN+I+ Y YN KLY+ + Q+ + YG Sbjct: 86 SNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYYG 127 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +2 Query: 557 SNNSINKTRY*LII----YNPKLYFYFGFFYQVVAKGTLMYG 670 SNN+I+ Y YN KLY+ + Q+ + YG Sbjct: 86 SNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYYG 127 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +2 Query: 557 SNNSINKTRY*LII----YNPKLYFYFGFFYQVVAKGTLMYG 670 SNN+I+ Y YN KLY+ + Q+ + YG Sbjct: 86 SNNTIHNNNYKYNYNNNNYNKKLYYNINYIEQIPIPVPVYYG 127 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 180 FRPDHLARSAPGRHEVDHDELVAC 109 F+P L A G HE ++ ++ C Sbjct: 37 FQPSFLGMEACGIHETTYNSIMKC 60 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +2 Query: 227 RWTLMSARTCQRVQH*LDADVRLR*EWQETGRILWR*RRQTQNNY 361 R T++ RT + ++H D +L+ W++ I R RR+ + Y Sbjct: 8 RPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQY 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,136 Number of Sequences: 438 Number of extensions: 3894 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -