BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0854 (694 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 56 3e-08 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 51 6e-07 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 50 1e-06 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 49 3e-06 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 48 8e-06 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 48 8e-06 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 47 1e-05 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 47 1e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 47 1e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 47 1e-05 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 46 2e-05 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 46 2e-05 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 45 4e-05 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 45 4e-05 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 45 4e-05 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 45 6e-05 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 44 1e-04 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 44 1e-04 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 43 2e-04 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 43 2e-04 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 43 2e-04 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 43 2e-04 At5g61340.1 68418.m07697 expressed protein 42 3e-04 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 42 4e-04 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 40 0.001 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 40 0.001 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 39 0.004 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 38 0.005 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 38 0.008 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 37 0.011 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 36 0.019 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 36 0.025 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 36 0.025 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 36 0.034 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 36 0.034 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 35 0.059 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 35 0.059 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 34 0.078 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 34 0.078 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 33 0.18 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 33 0.24 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 33 0.24 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 32 0.31 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 32 0.31 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 32 0.31 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 31 0.96 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 31 0.96 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 31 0.96 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 31 0.96 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 30 1.7 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 29 2.2 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 29 3.9 At4g31240.2 68417.m04435 expressed protein 28 6.8 At4g31240.1 68417.m04434 expressed protein 28 6.8 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 28 6.8 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 27 8.9 At1g78740.1 68414.m09177 hypothetical protein 27 8.9 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/63 (44%), Positives = 39/63 (61%), Gaps = 2/63 (3%) Frame = +1 Query: 28 EIRAFV*KPKMSIHIKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAE 201 EI F + IK+ + K+RL D KL+VI+F A WCGPCK + PKL+E+AA+ Sbjct: 28 EIYPFKVNSPCIVEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAK 87 Query: 202 MSD 210 +D Sbjct: 88 YTD 90 Score = 32.3 bits (70), Expect = 0.31 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +3 Query: 261 EYNINSMPTFVFVKNGKKLDEFSGANVD 344 E+N++++P VF+K G+++D G VD Sbjct: 107 EFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 51.2 bits (117), Expect = 6e-07 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +1 Query: 76 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 D D + AGDK+VV+D WCGPCK+I PK E++ + D + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMV 130 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +1 Query: 52 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 201 P M I I ++ L +AGD+LV++DF TWCG C+ + PKL + A E Sbjct: 93 PNM-IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE 141 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/37 (48%), Positives = 29/37 (78%) Frame = +1 Query: 106 EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 + +KL+VIDF A WCGPCK + P++ EIA++ S+++ Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSEAV 76 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 344 A Y ++P FVFVK G+++D GA D Sbjct: 89 AGTYRAITLPAFVFVKRGEEIDRVVGAKPD 118 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 47.6 bits (108), Expect = 8e-06 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = +1 Query: 76 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 D D + AG+KLVV+D WCGPCK+I PK ++ + D + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVV 120 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 47.6 bits (108), Expect = 8e-06 Identities = 18/39 (46%), Positives = 28/39 (71%) Frame = +1 Query: 100 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 L + DK V++DF ATWCGPC+++ P L+E++ + D I Sbjct: 71 LLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDII 109 Score = 34.3 bits (75), Expect = 0.078 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGA 335 A++Y I ++PTF+ K+GK D F GA Sbjct: 123 ANKYQIEALPTFILFKDGKLWDRFEGA 149 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 47.2 bits (107), Expect = 1e-05 Identities = 18/50 (36%), Positives = 30/50 (60%) Frame = +1 Query: 58 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMS 207 +SIH + KT+ A+ +L+++ F ATWCGPC+ + P +A + S Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS 322 Score = 36.3 bits (80), Expect = 0.019 Identities = 13/28 (46%), Positives = 24/28 (85%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGAN 338 A+ +NI+S+PTF F+++GK++D+ GA+ Sbjct: 338 AASWNISSVPTFCFIRDGKEVDKVVGAD 365 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = +1 Query: 49 KPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 195 KP M + DL L AGDKLVV+DF + CG CK + PK+ +IA Sbjct: 92 KPNMK-SVTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKIA 139 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 46.8 bits (106), Expect = 1e-05 Identities = 19/55 (34%), Positives = 34/55 (61%) Frame = +1 Query: 52 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E D + Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIV 156 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 46.8 bits (106), Expect = 1e-05 Identities = 19/55 (34%), Positives = 34/55 (61%) Frame = +1 Query: 52 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E D + Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIV 156 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +1 Query: 67 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDS 213 H D ++ A+ +KL+VIDF A+WC PC+MI P +++A + S Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSS 60 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGAN 338 A E+ + +MPTFVF+K G+ +D+ GAN Sbjct: 75 AKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = +1 Query: 64 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMS 207 I K+S D K A+ K+VV +F ATWCGPCK++ P E++ + S Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHS 75 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGAN 338 +S ++I + PTF F+KNG+++ + GAN Sbjct: 91 SSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 45.2 bits (102), Expect = 4e-05 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 210 +KL+V+DF A+WCGPC+MI P + +A + +D Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAMADKFND 78 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 344 A E+N+ +MPTFV VK GK+++ GA D Sbjct: 93 AKEFNVTAMPTFVLVKRGKEIERIIGAKKD 122 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 45.2 bits (102), Expect = 4e-05 Identities = 16/34 (47%), Positives = 25/34 (73%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 DK V++D+ ATWCGPC+ + P L+E++ + D I Sbjct: 81 DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKI 114 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGA 335 A++Y I ++PTF+ K+G+ D F GA Sbjct: 128 ANKYKIEALPTFILFKDGEPCDRFEGA 154 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +1 Query: 70 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 I + +L L AGDKLVV+DF + CG CK + PK+ + AEM+ + Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQF-AEMNPDV 149 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +1 Query: 91 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 K + A KL+VIDF ATWC PC+ I P ++A + D + Sbjct: 19 KLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVV 60 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGA 335 A E+ + +MPTF+F+K G+ + GA Sbjct: 73 AEEFKVQAMPTFIFMKEGEIKETVVGA 99 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSIXXXXXXXXECEDMP 258 VV+DF A WCGPCKMI P ++++A + I E + P Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTP 145 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 44.0 bits (99), Expect = 1e-04 Identities = 14/31 (45%), Positives = 24/31 (77%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 V+++F+ATWCGPCK+I P ++ ++ E D + Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKL 120 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +1 Query: 64 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 195 + I+ ++ L L AGD+LVV+DF + CG CK + PK+ ++A Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/66 (37%), Positives = 40/66 (60%) Frame = +1 Query: 10 ACSAGLEIRAFV*KPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDE 189 AC A A V P +S DS+ +T++ E+ D V+++F A WCGPC+MI P +D+ Sbjct: 75 ACEAQDTTAAAVEVPNLS----DSE-WQTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQ 128 Query: 190 IAAEMS 207 +A + + Sbjct: 129 LAKDFA 134 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGA 335 A+ Y I S+PT + K G+K D GA Sbjct: 151 ANRYGIRSVPTVIIFKGGEKKDSIIGA 177 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +1 Query: 91 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 K + A KL+VIDF A+WC PC+ I P E+A + ++ + Sbjct: 19 KVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVV 60 Score = 34.3 bits (75), Expect = 0.078 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 344 A E+ + +MPTFVF+K G +D GA D Sbjct: 73 AQEFKVEAMPTFVFMKEGNIIDRVVGAAKD 102 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = +1 Query: 79 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 195 +D L D+ V +DF A WCGPCKMI P ++E+A Sbjct: 80 NDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELA 118 >At5g61340.1 68418.m07697 expressed protein Length = 326 Score = 42.3 bits (95), Expect = 3e-04 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = -3 Query: 539 FFAFQRLQTQKLISSN-SLQTLKTFFIHLLKTYTC-FFFLIPS*FPSAAAYNFSLYLLVF 366 F + KL+S+N S + F++ LLKTY C FFFL+ SA A F+L+ L + Sbjct: 98 FLLLSKAYVIKLLSNNHSADSSSVFYLRLLKTYVCNFFFLL-----SANASAFALFFLAY 152 Query: 365 KDSCFEFVDVSAREFVQFLAI 303 + E S+R F FL++ Sbjct: 153 --NTLEAFGFSSRNFYTFLSL 171 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 41.9 bits (94), Expect = 4e-04 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +1 Query: 58 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEM 204 ++ H ++ + + + A LVV+DF A+WCGPC+ I P ++A ++ Sbjct: 9 IACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL 57 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 344 AS++ I +MPTF+F+K GK LD+ GA D Sbjct: 74 ASDWAIQAMPTFMFLKEGKILDKVVGAKKD 103 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +1 Query: 79 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE-MSDSIXXXXXXXXECEDM 255 SD L + +G K V+++F A WCG C+ + P LDE+A SDS D Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDF 439 Query: 256 P 258 P Sbjct: 440 P 440 Score = 37.5 bits (83), Expect = 0.008 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 +V++F A WCG CK + P+ ++ A+ +S ++ Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNV 80 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +1 Query: 79 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE-MSDSIXXXXXXXXECEDM 255 SD L + +G K V+++F A WCG C+ + P LDE+A SDS D Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDF 439 Query: 256 P 258 P Sbjct: 440 P 440 Score = 37.5 bits (83), Expect = 0.008 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 +V++F A WCG CK + P+ ++ A+ +S ++ Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNV 80 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/32 (46%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = +1 Query: 112 GDKLV--VIDFMATWCGPCKMIGPKLDEIAAE 201 GD+ V ++DF ATWCGPC ++ +L+ +A E Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVE 122 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 38.3 bits (85), Expect = 0.005 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 V+++F +WCGPC+M+ +DEIA + + + Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKL 117 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 37.5 bits (83), Expect = 0.008 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = +1 Query: 49 KPKMSIHIKDSDDLKTRLAEAGD-------KLVVIDFMATWCGPCKMIGPKLDEIA 195 K I ++++ +K +AE+ D K V+I+F A WCG C+ + P LDE+A Sbjct: 361 KKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 Score = 36.3 bits (80), Expect = 0.019 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAEMS 207 +V++F A WCG C+ + P+ ++ A+E+S Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELS 76 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 344 AS+ + +MPTF+F+K+G +D+ GAN D Sbjct: 70 ASQLEVKAMPTFLFLKDGNAMDKLVGANPD 99 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 36.3 bits (80), Expect = 0.019 Identities = 12/29 (41%), Positives = 23/29 (79%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAEMSD 210 ++I++MA+WC C + PKL+++AAE ++ Sbjct: 121 IIIEWMASWCRKCIYLKPKLEKLAAEYNN 149 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 35.9 bits (79), Expect = 0.025 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 70 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMSD 210 +K ++ +++A D + V F A WCGPC+ I P + E++ + D Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPD 137 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +1 Query: 70 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMSD 210 +K + + L++A D + V F A WCGPC++I P + E++ + D Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPD 102 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 35.5 bits (78), Expect = 0.034 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 118 KLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 K + + F A WCGPC+ P+L E+ E+S + Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNELSSKV 76 Score = 35.1 bits (77), Expect = 0.045 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +1 Query: 67 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 210 ++ D K +++ K +++ F A WC PC+ PKL E+ ++ + Sbjct: 347 YVLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEVYKQIKE 394 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 35.5 bits (78), Expect = 0.034 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIA 195 + +DF A WCG CK + P+LD A Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAA 75 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 34.7 bits (76), Expect = 0.059 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIAA 198 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 Score = 33.9 bits (74), Expect = 0.10 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIA 195 +K V+++F A WCG CK + P +++A Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVA 185 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 34.7 bits (76), Expect = 0.059 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIAA 198 DK +++F A WCG CK + P+ +++ A Sbjct: 40 DKGALVEFYAPWCGHCKKLAPEYEKLGA 67 Score = 33.9 bits (74), Expect = 0.10 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIA 195 +K V+++F A WCG CK + P +++A Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVA 185 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 34.3 bits (75), Expect = 0.078 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAE 201 VVI +MA WC C + PKL+++AAE Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAE 126 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 34.3 bits (75), Expect = 0.078 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 49 KPKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 +P S+ + S D+L T E L +++F A WCG CK + P+ + A + + Sbjct: 161 EPSASVELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKV 214 Score = 31.9 bits (69), Expect = 0.41 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = +1 Query: 121 LVVIDFMATWCGPCKMIGPKLDEIAAEM 204 +V+++F A WCG C+ + P +++A+ + Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTL 75 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 33.1 bits (72), Expect = 0.18 Identities = 11/27 (40%), Positives = 22/27 (81%) Frame = +3 Query: 255 ASEYNINSMPTFVFVKNGKKLDEFSGA 335 ++E+N+ + PT VF+K+G+++D+ GA Sbjct: 54 SNEWNVEATPTVVFLKDGRQMDKLVGA 80 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 103 AEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 A + K++V++F A+WC P K I P E+A+ + I Sbjct: 58 ANSHGKILVVNFKASWCLPSKTILPIYQELASTYTSMI 95 Score = 31.5 bits (68), Expect = 0.55 Identities = 10/26 (38%), Positives = 21/26 (80%) Frame = +3 Query: 261 EYNINSMPTFVFVKNGKKLDEFSGAN 338 E+N+++ PT VF+K+G+++D+ G + Sbjct: 110 EWNVDATPTVVFLKDGRQMDKLVGGD 135 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 32.7 bits (71), Expect = 0.24 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +1 Query: 121 LVVIDFMATWCGPCKMIGPKLDEIA 195 +V+++F A WCG CK + P +++A Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVA 74 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +1 Query: 49 KPKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 +P S+ + S DDL ++L +++F A WCG CK + P+ A + + Sbjct: 160 EPSASVELNASNFDDLVIE----SNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKV 213 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 32.3 bits (70), Expect = 0.31 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 210 ++ V+++F A WCG C+ + P+ A E+ + Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKE 151 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +1 Query: 118 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 204 K V+++ A WCG C+ + P +++A + Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 32.3 bits (70), Expect = 0.31 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 210 ++ V+++F A WCG C+ + P+ A E+ + Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKE 151 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +1 Query: 118 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 204 K V+++ A WCG C+ + P +++A + Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHL 488 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 112 GDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 G KL+V+D CGPC + P + +++ MS+++ Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETV 240 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 30.7 bits (66), Expect = 0.96 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 124 VVIDFMATWCGPCKMIGPKLDEIAAE 201 V++ F A WCGPC+ + P L+++ +E Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSE 255 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 73 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 210 K D+L + L ++ + LVV+DF T CG CK I ++ + D Sbjct: 104 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGD 151 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 73 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 210 K D+L + L ++ + LVV+DF T CG CK I ++ + D Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGD 138 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 73 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMSD 210 K D+L + L ++ + LVV+DF T CG CK I ++ + D Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGD 138 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 264 YNINSMPTFVFVKNGKKLDEFSGAN 338 Y++ ++P FVF K+GK +D GA+ Sbjct: 70 YSVAAVPYFVFFKDGKTVDTLEGAD 94 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +1 Query: 115 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM 204 + +++F A WCG C+ + P+ A E+ Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATEL 145 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 264 YNINSMPTFVFVKNGKKLDEFSGAN 338 Y++ +P FVF K+GK +D GA+ Sbjct: 70 YSVALVPYFVFFKDGKTVDTLEGAD 94 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 118 KLVVIDFMATWCGPCKMIGPKL 183 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 118 KLVVIDFMATWCGPCKMIGPKL 183 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 82 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMS 207 DD+K+ + A VI++ A+WCG C I P +++ S Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLSNSFS 73 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 267 NINSMPTFVFVKNGKKLDEFSGA 335 +I PTF F ++G+K+DE GA Sbjct: 91 HIRYTPTFQFYRDGEKVDEMFGA 113 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 27.5 bits (58), Expect = 8.9 Identities = 8/40 (20%), Positives = 23/40 (57%) Frame = +1 Query: 97 RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMSDSI 216 +L +++++ + + CGPC+ + P L+++ E + + Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDEYNHDV 475 >At1g78740.1 68414.m09177 hypothetical protein Length = 306 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 382 SIYLCLRIVVLSLSTLA-PENSSSFLPFLTKTNVG 281 +IY+C +V L LST+ P S LPFL +G Sbjct: 94 TIYICESLVSLKLSTVTLPSVKSVSLPFLRVLKLG 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,924,027 Number of Sequences: 28952 Number of extensions: 262058 Number of successful extensions: 752 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -