BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0852 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 9.1 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 23 9.1 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.0 bits (47), Expect = 9.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -3 Query: 581 SSRIARTIFNETHHIQPGTKQSRHSWLNFKIFPLSKNL 468 ++R T N THH G +RHS + P SK L Sbjct: 160 ATRYGTTGGNATHHRTTGVFVTRHSTTGSSVRP-SKGL 196 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 23.0 bits (47), Expect = 9.1 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = -3 Query: 254 YHFSQPFSLFYRVFWVHLE 198 +HF ++++YR W+ L+ Sbjct: 8 FHFLFMYNIYYRALWLFLK 26 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,169 Number of Sequences: 2352 Number of extensions: 12844 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -