BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0848 (695 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF040645-4|AAB94974.1| 306|Caenorhabditis elegans Hypothetical ... 29 4.2 Z78546-3|CAB01768.2| 361|Caenorhabditis elegans Hypothetical pr... 27 9.7 AC006648-9|AAF39858.2| 306|Caenorhabditis elegans Btb and math ... 27 9.7 >AF040645-4|AAB94974.1| 306|Caenorhabditis elegans Hypothetical protein F52C6.8 protein. Length = 306 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 206 TRPLLMHY*YRICIIYNTIPTQENLSVYHFNVHFYMARKHENIIIQKYLH 355 T+ +H+ Y+ T + S HFNV +YMA H+ + YLH Sbjct: 5 TKEFQLHHSYKNVSKLEDEGTLLSPSEEHFNVQWYMAVSHKKEDMAVYLH 54 >Z78546-3|CAB01768.2| 361|Caenorhabditis elegans Hypothetical protein T21H8.2 protein. Length = 361 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 379 LSHSCQFFMEIFLYNNILVFSSHVEMYVKVIYRQIFLGRY 260 L+ SC F +FL++ +L +H + ++ Y LG Y Sbjct: 100 LTPSCSFIRRMFLFSIMLTTLTHASLTLERAYATYQLGAY 139 >AC006648-9|AAF39858.2| 306|Caenorhabditis elegans Btb and math domain containingprotein 3 protein. Length = 306 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 290 HFNVHFYMARKHENIIIQKYLH 355 HFNV +YMA H+ + YLH Sbjct: 33 HFNVQWYMAVSHKKEDMAVYLH 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,500,689 Number of Sequences: 27780 Number of extensions: 354510 Number of successful extensions: 779 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 779 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -