BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0846 (662 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 24 1.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 9.0 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 9.0 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 9.0 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.8 bits (49), Expect = 1.3 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 Query: 274 YNNDILCSLCQYSSYMFIKNYVEPEPAV 357 YN D+ C+ Q Y+ + N P P + Sbjct: 365 YNQDVSCTHYQNPEYISVVNPESPYPQI 392 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 574 LLPITESYFLYINQPINCKLLFK-YSMFFQISM 479 L+ I SYF YI CK++ + +S F +++ Sbjct: 382 LINIFASYFAYIFGKFACKIMIQGFSYAFPVNL 414 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 574 LLPITESYFLYINQPINCKLLFK-YSMFFQISM 479 L+ I SYF YI CK++ + +S F +++ Sbjct: 382 LINIFASYFAYIFGKFACKIMIQGFSYAFPVNL 414 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 574 LLPITESYFLYINQPINCKLLFK-YSMFFQISM 479 L+ I SYF YI CK++ + +S F +++ Sbjct: 382 LINIFASYFAYIFGKFACKIMIQGFSYAFPVNL 414 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 574 LLPITESYFLYINQPINCKLLFK-YSMFFQISM 479 L+ I SYF YI CK++ + +S F +++ Sbjct: 382 LINIFASYFAYIFGKFACKIMIQGFSYAFPVNL 414 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 661 WFYPYAALYLEDQSLHCK 608 W+ PY YL++ +L+ K Sbjct: 37 WYNPYYYQYLQNAALYHK 54 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 271 LLVTLSCCYISSLCVILFN 215 LL L C++ S C+ +FN Sbjct: 217 LLYRLLRCWLISKCIYVFN 235 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 271 LLVTLSCCYISSLCVILFN 215 LL L C++ S C+ +FN Sbjct: 217 LLYRLLRCWLISKCIYVFN 235 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,381 Number of Sequences: 336 Number of extensions: 2720 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -