BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0846 (662 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0511 + 18435745-18436499,18436624-18436742,18436788-184373... 28 7.6 08_02_1143 + 24659105-24659386,24660171-24660272,24661259-246615... 28 7.6 >10_08_0511 + 18435745-18436499,18436624-18436742,18436788-18437372, 18438534-18438667,18439128-18439148,18439656-18439739, 18439832-18440077,18440763-18440925,18441024-18441066, 18441392-18441773,18442212-18442267,18442351-18442417, 18442542-18442721 Length = 944 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 56 ETGSMLESTSHATVRHSI-KFDYVDELIQMLKDPLNYGLFLDDYSANILLNELLVKKNYT 232 E+G+ +E +++ + H + K D+ +QM ++ L L+ + NI+++ LL Sbjct: 361 ESGTQIELSTYNIILHGLCKNKLTDDALQMFQNLCLMDLKLEARTFNIMIDALLKVGRND 420 Query: 233 QAADI 247 +A D+ Sbjct: 421 EAKDL 425 >08_02_1143 + 24659105-24659386,24660171-24660272,24661259-24661521, 24661775-24661874,24662080-24662238,24662327-24663147, 24663299-24663618,24665831-24667398 Length = 1204 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +2 Query: 86 HATVRHSIKFDYVDELIQMLKDPLNYGLFLDDYSANILL 202 +AT++ ++ DE++Q+ + YG+ LDD S N ++ Sbjct: 946 NATMKVLLRARLFDEVLQLFESSETYGVELDDISYNTVV 984 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,298,082 Number of Sequences: 37544 Number of extensions: 218000 Number of successful extensions: 383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -