BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0846 (662 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D87453-1|BAA13394.1| 415|Homo sapiens KIAA0264 protein. 46 2e-04 BC064902-1|AAH64902.1| 414|Homo sapiens mitochondrial ribosomal... 46 2e-04 >D87453-1|BAA13394.1| 415|Homo sapiens KIAA0264 protein. Length = 415 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/56 (30%), Positives = 34/56 (60%) Frame = +2 Query: 80 TSHATVRHSIKFDYVDELIQMLKDPLNYGLFLDDYSANILLNELLVKKNYTQAADI 247 T H +R +K+D D+ + L + + YG+F D+++ N+L++ + K+NY A + Sbjct: 109 TIHTWIRQCLKYDAQDKALYTLVNKVQYGIFPDNFTFNLLMDSFIKKENYKDALSV 164 >BC064902-1|AAH64902.1| 414|Homo sapiens mitochondrial ribosomal protein S27 protein. Length = 414 Score = 45.6 bits (103), Expect = 2e-04 Identities = 17/56 (30%), Positives = 34/56 (60%) Frame = +2 Query: 80 TSHATVRHSIKFDYVDELIQMLKDPLNYGLFLDDYSANILLNELLVKKNYTQAADI 247 T H +R +K+D D+ + L + + YG+F D+++ N+L++ + K+NY A + Sbjct: 108 TIHTWIRQCLKYDAQDKALYTLVNKVQYGIFPDNFTFNLLMDSFIKKENYKDALSV 163 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,914,203 Number of Sequences: 237096 Number of extensions: 1331909 Number of successful extensions: 5431 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5431 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7478817430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -