BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0845 (690 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1020.03 |||mitochondrial iron ion transporter|Schizosaccharo... 27 2.6 SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 26 4.5 >SPCC1020.03 |||mitochondrial iron ion transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 397 Score = 27.1 bits (57), Expect = 2.6 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +2 Query: 443 SSFTHAEHSHSKSKLTLAEK*MSLVTAFQMFYLRPYISCK-HDVIEKTISI*YI*NY*DH 619 S TH HSH+ S+L M+L F L+ ++ K V +KT S + N H Sbjct: 179 SEHTHIGHSHNPSQLLFEHPFMALGLIFGSVVLKEWLFRKTRTVAQKTDSNILLANAWHH 238 Query: 620 QQD 628 + D Sbjct: 239 RAD 241 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 26.2 bits (55), Expect = 4.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 416 ELWLEDPTITGISGYYSLWDIS 351 E W DPTI I G ++W ++ Sbjct: 1470 EFWKRDPTIAPIRGALAVWGLT 1491 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,595,288 Number of Sequences: 5004 Number of extensions: 48546 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -