BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0844 (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501... 29 4.6 07_01_1124 + 10392909-10392974,10393037-10393455,10393503-103936... 28 8.1 >02_03_0412 - 18749430-18749587,18749696-18749857,18750062-18750194, 18751640-18751744,18751818-18751935,18752232-18752320, 18752407-18753660,18753785-18753831,18754285-18754339, 18754783-18754884 Length = 740 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -2 Query: 519 NFRFYLPDNRIWMVNSLVSFEFI*WSSLSCIAYNSPC 409 NF+F + D + + + + + W + C+ Y SPC Sbjct: 192 NFKFVVLDTGSYEIELMDPDKMLQWEDIVCVRYYSPC 228 >07_01_1124 + 10392909-10392974,10393037-10393455,10393503-10393657, 10393792-10394247,10394379-10395298 Length = 671 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 349 KILKCYFTNVRNIISTVSKCYYNVYLH 269 K+L Y TN++ IIST K + N+ H Sbjct: 425 KVLSRYSTNIKRIISTKEKKFTNLKSH 451 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,933,140 Number of Sequences: 37544 Number of extensions: 290281 Number of successful extensions: 599 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -