BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0844 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_30797| Best HMM Match : Notch (HMM E-Value=2.4e-07) 29 2.7 SB_345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_17802| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5834 Score = 31.1 bits (67), Expect = 0.89 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = -1 Query: 331 FTNVRNIISTVSKCYYNVYLHYLLKENNEHIYLFVYITYVN 209 F + I T+++ YYN+ LH +++ N+ ++ I+Y + Sbjct: 5290 FDKCKAIGLTLAQTYYNICLHDIIQSENQQFAIYAVISYAD 5330 >SB_30797| Best HMM Match : Notch (HMM E-Value=2.4e-07) Length = 778 Score = 29.5 bits (63), Expect = 2.7 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = +2 Query: 626 PLPSCSPGCPATW 664 P+P+C+ GCPA+W Sbjct: 4 PVPNCNDGCPASW 16 >SB_345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1213 Score = 29.5 bits (63), Expect = 2.7 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = +2 Query: 626 PLPSCSPGCPATW 664 P+P+C+ GCPA+W Sbjct: 411 PVPNCNDGCPASW 423 >SB_17802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 229 QISKYVHYFLSRDNVGIHYNNILTQSKLY 315 Q++KY Y + N+ HY ++ T KLY Sbjct: 118 QVAKYHSYRCTSSNIPTHYRSMWTYIKLY 146 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,236,110 Number of Sequences: 59808 Number of extensions: 355959 Number of successful extensions: 714 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -