BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0844 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.6 AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor prot... 23 2.8 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 3.6 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 8.4 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 8.4 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 8.4 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 560 KDSLLSRKFEETTKNEMCRIIIPLPSCSPGCPA 658 K + R + T +++C + P+ SC+ GC A Sbjct: 1685 KHCTIHRTQVKETDDKICFTMRPVVSCASGCTA 1717 >AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor protein. Length = 72 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = +3 Query: 399 LENYMENYMQYKIMSSIK*IRMKPNCLPSKFDCRADRNE 515 ++ YM Q + + M+P C+ ++ C R E Sbjct: 28 IDMYMRRKCQECRLKKCLTVGMRPECMVPEYQCAVKRKE 66 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = +3 Query: 399 LENYMENYMQYKIMSSIK*IRMKPNCLPSKFDCRADRNE 515 ++ YM Q + + M+P C+ ++ C R E Sbjct: 231 IDMYMRRKCQECRLKKCLTVGMRPECVVPEYQCAVKRKE 269 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 186 LHSDRYIGGWKKCI 145 LHSDR + + KC+ Sbjct: 38 LHSDRLLNNYFKCL 51 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 186 LHSDRYIGGWKKCI 145 LHSDR + + KC+ Sbjct: 38 LHSDRLLNNYFKCL 51 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 186 LHSDRYIGGWKKCI 145 LHSDR + + KC+ Sbjct: 38 LHSDRLLNNYFKCL 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,280 Number of Sequences: 438 Number of extensions: 4376 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -