BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0842 (695 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF045644-7|AAC02603.1| 262|Caenorhabditis elegans Mechanosensor... 30 1.8 Z50006-2|CAD44148.1| 523|Caenorhabditis elegans Hypothetical pr... 27 9.7 >AF045644-7|AAC02603.1| 262|Caenorhabditis elegans Mechanosensory abnormality protein17 protein. Length = 262 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = -1 Query: 458 FYTALNAEQLRLGNQIDNDIFLLNSIIDSQLCCDVPSISPI*WTSYRKGLINPI 297 FY + ++ +G QI + +F QL D PS++ + + S + GLI P+ Sbjct: 111 FYVHFSCQRQGVGQQILDYMFSQEHTEPYQLALDNPSVTLLGFMSQKYGLIKPV 164 >Z50006-2|CAD44148.1| 523|Caenorhabditis elegans Hypothetical protein T07C5.1c protein. Length = 523 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 472 KTHRHFTQPLMQNN*DL-EIRSTMTFSYLIPLSILNYVVMSQVFRRFS 332 +T HF L NN + E F YL +S+LN+VV ++F+R S Sbjct: 476 ETSEHFD--LESNNLSIIEHNHLDLFFYLCIISLLNFVVYRKIFKRKS 521 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,404,634 Number of Sequences: 27780 Number of extensions: 339574 Number of successful extensions: 645 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -