BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0842 (695 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 24 1.2 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 2.8 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 6.4 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 586 TKDTINFVFQ*ALRGRGYYIMSTK 515 TKDT+N V Q A+ G I S K Sbjct: 243 TKDTLNSVVQGAIHGDSRQIQSRK 266 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 418 IRSTMTFSYLIPLSILNYVVMSQVFRRFSGHRTA 317 + + TFSY IP+ ++ Y SQ+ H A Sbjct: 212 VATIFTFSYCIPMILIIY-YYSQIVSHVVNHEKA 244 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 590 YNKRYNKFRFPVSTTRTRLLYY 525 YN YN + +T +L YY Sbjct: 94 YNNNYNNYNNNYNTNYKKLQYY 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,295 Number of Sequences: 438 Number of extensions: 4573 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -