BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0839 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0685 + 6025975-6026074,6026168-6026357,6026963-6027034,602... 29 4.6 01_01_0501 - 3682100-3682148,3682263-3682341,3682434-3682511,368... 28 8.0 >08_01_0685 + 6025975-6026074,6026168-6026357,6026963-6027034, 6027187-6027258,6027354-6027425,6027784-6027855, 6027980-6028051,6028134-6028205,6028483-6028554, 6028791-6028865,6028970-6029041,6029134-6029199, 6029267-6029332,6029409-6029453,6029542-6029606, 6029697-6030076,6030455-6030653,6030725-6030883, 6030966-6031084,6031156-6031200,6031226-6031791, 6031871-6032021,6032117-6032454,6033702-6033765, 6034329-6034370,6035572-6035575,6035853-6036039, 6037252-6037323,6037687-6037758,6037867-6037938, 6038019-6038090,6038651-6038725,6038815-6038886, 6038988-6039053,6039163-6039228,6039348-6039392, 6039469-6039533,6039615-6039994,6040070-6040202, 6040354-6040512,6040599-6040717,6040805-6041015, 6041155-6041386,6041469-6041619,6041725-6042084 Length = 1952 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = -3 Query: 445 D*TIKIPKFIGSYYHTNNKLLHNLYVSLNTA---FTSDAGFCLLSVRFSRL 302 D T KIP + GS+ + + +L N +S N F+ AG LL + F+ + Sbjct: 1224 DLTGKIPDYFGSFPNLQDLILRNCKISDNLGTVNFSKLAGLTLLDLSFNNI 1274 >01_01_0501 - 3682100-3682148,3682263-3682341,3682434-3682511, 3682770-3682866,3682944-3683029,3683310-3683381, 3683451-3683520,3683988-3684110,3684212-3684370, 3684443-3684730,3685652-3685725,3686107-3686344 Length = 470 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 317 SFLKIKDCLNLTIGALCLLVCLSILKIVMCNCLC 216 S + K LNL + + L+C+S +MC C C Sbjct: 161 SIMASKKDLNLALILMHALLCMSTFTYLMCICAC 194 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,052,142 Number of Sequences: 37544 Number of extensions: 287634 Number of successful extensions: 515 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -