BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0839 (690 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 30 2.6 BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p pro... 30 2.6 AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB... 30 2.6 >U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade protein. Length = 1047 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 347 F*CGLLSFICSFLKIKDCLNLTIGALCLLVCLSILKIVMC 228 F GLL I S KDC + + L L+C +L V C Sbjct: 39 FLSGLLDTITSTADSKDCPGVCVHTLATLICYEVLDDVAC 78 >BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p protein. Length = 1047 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 347 F*CGLLSFICSFLKIKDCLNLTIGALCLLVCLSILKIVMC 228 F GLL I S KDC + + L L+C +L V C Sbjct: 39 FLSGLLDTITSTADSKDCPGVCVHTLATLICYEVLDDVAC 78 >AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB protein. Length = 1047 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 347 F*CGLLSFICSFLKIKDCLNLTIGALCLLVCLSILKIVMC 228 F GLL I S KDC + + L L+C +L V C Sbjct: 39 FLSGLLDTITSTADSKDCPGVCVHTLATLICYEVLDDVAC 78 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,070,011 Number of Sequences: 53049 Number of extensions: 540197 Number of successful extensions: 1125 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1124 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3005453946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -