BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0839 (690 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100655-2|AAK68684.2| 366|Caenorhabditis elegans Map kinase ac... 28 5.5 AF100655-1|AAC68944.1| 443|Caenorhabditis elegans Map kinase ac... 28 5.5 >AF100655-2|AAK68684.2| 366|Caenorhabditis elegans Map kinase activated protein kinaseprotein 2, isoform b protein. Length = 366 Score = 28.3 bits (60), Expect = 5.5 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +3 Query: 189 ICSDAIFL*T*TIAHNDLQNGKTY*KTKSSNR*IK-TIFNLEKRTDKRQKPASEVNAVFN 365 ICS L +IAH DL+ T +SN +K T F K+TD+ +P A F Sbjct: 119 ICSAVAHLHRMSIAHRDLKPENLLYVTTASNAALKLTDFGFAKKTDE-SEPQGLKTACFT 177 Query: 366 DTY 374 Y Sbjct: 178 PYY 180 >AF100655-1|AAC68944.1| 443|Caenorhabditis elegans Map kinase activated protein kinaseprotein 2, isoform a protein. Length = 443 Score = 28.3 bits (60), Expect = 5.5 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +3 Query: 189 ICSDAIFL*T*TIAHNDLQNGKTY*KTKSSNR*IK-TIFNLEKRTDKRQKPASEVNAVFN 365 ICS L +IAH DL+ T +SN +K T F K+TD+ +P A F Sbjct: 196 ICSAVAHLHRMSIAHRDLKPENLLYVTTASNAALKLTDFGFAKKTDE-SEPQGLKTACFT 254 Query: 366 DTY 374 Y Sbjct: 255 PYY 257 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,315,019 Number of Sequences: 27780 Number of extensions: 312442 Number of successful extensions: 653 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -