BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0838 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_2075| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_41789| Best HMM Match : Mucin (HMM E-Value=0.56) 28 8.3 SB_41192| Best HMM Match : Mucin (HMM E-Value=0.56) 28 8.3 SB_9453| Best HMM Match : Mucin (HMM E-Value=0.56) 28 8.3 SB_55577| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_14644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 537 CIKMLSYLSHVTVDNYKSESQTLYWPGISK*TWFVHSILFCFYLIMWFIFLF 692 CI + +L ++VD Y S ++ L +P TW ++ + LI W F Sbjct: 113 CISSIMHLMLLSVDKYLSIARPLLYP-----TWMTTRKVYIYCLIAWIYSAF 159 >SB_2075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 518 NYTVVSLY*NVIISLSCDC*QL--QERVTNIVLARNQ*INMVCTFHIILFLLDYV 676 N T + L NVI +S C + Q+R NI LARN + T I F++D++ Sbjct: 63 NVTEIILL-NVIYDISAYCTSIVAQDRKGNIFLARNLDYDFSNTLRKITFIVDFM 116 >SB_41789| Best HMM Match : Mucin (HMM E-Value=0.56) Length = 683 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 85 SLDAEQPQQQGCTGLEICENEQGTNAR 5 S E+ + QG G E EN++GTNAR Sbjct: 291 SKSEERQETQGIDGNESEENDEGTNAR 317 >SB_41192| Best HMM Match : Mucin (HMM E-Value=0.56) Length = 683 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 85 SLDAEQPQQQGCTGLEICENEQGTNAR 5 S E+ + QG G E EN++GTNAR Sbjct: 291 SKSEERQETQGIDGNESEENDEGTNAR 317 >SB_9453| Best HMM Match : Mucin (HMM E-Value=0.56) Length = 642 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 85 SLDAEQPQQQGCTGLEICENEQGTNAR 5 S E+ + QG G E EN++GTNAR Sbjct: 291 SKSEERQETQGIDGNESEENDEGTNAR 317 >SB_55577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 27.9 bits (59), Expect = 8.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 33 HISRPVQPCCCGC 71 H+ PV PCCC C Sbjct: 77 HVELPVSPCCCLC 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,865,298 Number of Sequences: 59808 Number of extensions: 369772 Number of successful extensions: 758 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -