BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0836 (695 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00063-3|AAK18959.2| 446|Caenorhabditis elegans Hypothetical pr... 30 1.8 Z81115-3|CAB03293.2| 486|Caenorhabditis elegans Hypothetical pr... 27 9.7 >U00063-3|AAK18959.2| 446|Caenorhabditis elegans Hypothetical protein F56C9.3 protein. Length = 446 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +1 Query: 355 YRHPAYFCREAVMSFDWAAVVTILETLQLIFQGGWRIYDVDVYRLQ*PLNTS 510 Y++P R +S +V+ + ++QLI RI+D VY ++ P+N S Sbjct: 193 YQYPRGRTRVEPLSLILISVIMGMASVQLIISSVRRIHDAAVYGIKDPINVS 244 >Z81115-3|CAB03293.2| 486|Caenorhabditis elegans Hypothetical protein T05D4.3 protein. Length = 486 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = -3 Query: 687 LLRSLTLVKGNVELDVQRRSILDRLSRGTVSLGTFASTLPVTISSLFI 544 +L ++TLV + + R++I L+ +VSLGT +L T+ +F+ Sbjct: 282 VLSAITLVVTVFNIYLMRKTIQKSLTAISVSLGTVLFSLSTTVIGVFM 329 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,570,582 Number of Sequences: 27780 Number of extensions: 315834 Number of successful extensions: 641 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -