BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0836 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g61630.1 68416.m06907 AP2 domain-containing transcription fac... 31 0.73 At3g05870.1 68416.m00660 zinc finger (C3HC4-type RING finger) fa... 30 1.7 >At3g61630.1 68416.m06907 AP2 domain-containing transcription factor, putative transcription factor Pti6 - Lycopersicon esculentum, PIR:T07728 Length = 315 Score = 31.1 bits (67), Expect = 0.73 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -2 Query: 694 IPSAAIPDTRKRQRGT*CSKKIDFGPTISWDCIPWDVCFYLACHHQLF 551 I S +P+T ++G ++ +FG ++ PWDV + HH F Sbjct: 267 IQSTLLPNTEVSKQGENETEDFEFGLIDDFESSPWDVDHFFDHHHHSF 314 >At3g05870.1 68416.m00660 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 57 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -2 Query: 604 DC-IPWDVC--FYLACHHQLFIYLLLRWVNELTA 512 DC +P D C + AC+H ++ +L+WVN T+ Sbjct: 9 DCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTS 42 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,580,785 Number of Sequences: 28952 Number of extensions: 289992 Number of successful extensions: 553 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -