BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0833 (695 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.15c |ksg1||serine/threonine protein kinase Ksg1|Schizosa... 27 3.4 SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyc... 26 4.5 >SPCC576.15c |ksg1||serine/threonine protein kinase Ksg1|Schizosaccharomyces pombe|chr 3|||Manual Length = 592 Score = 26.6 bits (56), Expect = 3.4 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = -1 Query: 251 SLIPREQNICFIVMTTESSQNNNPQIEWRIPYICK--PSQNSAFPNLVKIVTDFK 93 S IP+ + + S +++P+I +P+I PS ++ PN +K V+DFK Sbjct: 47 SAIPQSNALNTTPNESTSQIDSSPKIPSAVPHISTPNPSSGASTPN-IKRVSDFK 100 >SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 523 TYIFYL*FLSQIIFSNNEFSLSF 455 T +F + + Q +F NEFSLSF Sbjct: 30 TEVFGMKLIDQWVFEENEFSLSF 52 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,812,117 Number of Sequences: 5004 Number of extensions: 56614 Number of successful extensions: 118 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -