BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0833 (695 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_40017| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 >SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +1 Query: 73 ILHSLNNLKSVTILTRLGNALFCDGLQIYGILHSIW 180 ILH NNLK+ +L RL N + L +Y I H IW Sbjct: 236 ILHDKNNLKA--LLVRLQNHFALNRLNVYMIFHLIW 269 >SB_40017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +1 Query: 25 VLQSPTKRICLYKQVNILHSLNNLKSVTILTRLGNALFCD 144 VL S K L K++ ILHSLN K R CD Sbjct: 319 VLPSNGKARSLVKRLKILHSLNETKKTCFTLRFAEVFSCD 358 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,629,821 Number of Sequences: 59808 Number of extensions: 379898 Number of successful extensions: 726 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -