BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0832 (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1271 + 28883904-28884326,28885556-28886242 28 8.1 01_05_0531 - 22988663-22990282 28 8.1 >06_03_1271 + 28883904-28884326,28885556-28886242 Length = 369 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 255 LANMMGEDPELFTQKDVERAIEYLFPSGIYDPAARPSMRPPEDV 386 L M+ DP + V A+E+ + S +YDP+A P + P D+ Sbjct: 296 LQKMLVFDPS--KRISVTEALEHPYMSPLYDPSANPPAQVPIDL 337 >01_05_0531 - 22988663-22990282 Length = 539 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 677 IFPWTTLENCHILNQKSFQLTTAQVDLYSPTYYPRVV-NCHLDQELL 540 +F WT + +CH+ N + + LY Y V+ N H LL Sbjct: 116 VFTWTAMVSCHVRNGEPREAVQLFAALYGELYERGVLPNAHTLSSLL 162 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,201,904 Number of Sequences: 37544 Number of extensions: 370018 Number of successful extensions: 955 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -