BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0831 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 26 0.39 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 1.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 24 1.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.6 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 2.1 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 2.1 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 2.1 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 2.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 2.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 2.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.1 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 23 2.7 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 23 2.7 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 23 2.7 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.7 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 23 2.7 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 2.7 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 2.7 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 2.7 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 2.7 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 2.7 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 2.7 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 2.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 2.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 2.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 2.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 2.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 2.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 2.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 2.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 2.7 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.7 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 2.7 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 3.6 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 3.6 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 3.6 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 3.6 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 3.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 3.6 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 3.6 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 3.6 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 3.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 3.6 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 3.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 3.6 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 3.6 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 3.6 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 3.6 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 3.6 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 3.6 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 3.6 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 3.6 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 23 3.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 3.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 3.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 3.6 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 3.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 3.6 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 4.8 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 4.8 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 6.3 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 6.3 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 8.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 8.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 8.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 8.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 8.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 8.4 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 8.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.4 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.8 bits (54), Expect = 0.39 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +1 Query: 403 LRGTAALPGRPGNAAGVPGYPAGPEPAYRVVKRY 504 +R T +PG + GV G P A V RY Sbjct: 528 IRSTDVIPGTQEHVCGVKGIPCSWGRAINVANRY 561 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 263 PISVRGQNPVRVXGLPRSTLQPDLRRHPEDARP 361 P SV +P R G PR R HP RP Sbjct: 130 PPSVSLSSPPREPGTPRINFTKLKRHHPRYKRP 162 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = +2 Query: 359 PTGXRGDSRRPTTSVSAVRRPCQAARAMPLVFRDTPLGQNQP 484 PT +P ++RP A + P F PLG +P Sbjct: 289 PTYRMQQVEQPVQVYIQLKRPSDGATSEPFPFLMLPLGAGRP 330 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = +2 Query: 359 PTGXRGDSRRPTTSVSAVRRPCQAARAMPLVFRDTPLGQNQP 484 PT +P ++RP A + P F PLG + P Sbjct: 289 PTYRMQQVEQPVQVYIQLKRPSDGATSEPFPFLMLPLGADDP 330 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 158 YIGPSTPFPRFIPPNAYRLRPPLNP 182 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 158 YIGPSTPFPRFIPPNAYRLRPPLNP 182 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPSTPFPRFIPPNAYRFRPPLNP 174 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 366 YIGPSTPFPRFIPPNAYRFRPPLNP 390 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 377 YIGPSTPFPRFIPPNAYRFRPPLNP 401 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 383 YIGPSTPFPRFIPPNAYRFRPPLNP 407 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 383 YIGPSTPFPRFIPPNAYRFRPPLNP 407 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 148 YIGPPTPFPRFIPPNAYRFRPPLNP 172 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 148 YIGPPTPFPRFIPPNAYRFRPPLNP 172 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 148 YIGPPTPFPRFIPPNAYRFRPPLNP 172 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPPTPFPRFIPPNAYRFRPPLNP 174 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPPTPFPRFIPPNAYRFRPPLNP 174 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPPTPFPRFIPPNAYRFRPPLNP 174 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPPTPFPRFIPPNAYRFRPPLNP 174 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPPTPFPRFIPPNAYRFRPPLNP 174 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 154 YIGPPTPFPRFIPPNAYRFRPPLNP 178 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPPTPFPRFIPPNAYRFRPPLNP 174 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 149 YIGPPTPFPRFIPPNAYRFRPPQNP 173 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 149 YIGPPTPFPRFIPPNAYRFRPPQNP 173 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 152 IGPSTPFPRFISPNAYRFRPPLNP 175 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 155 YIGPPTPFPRFIPPNAYRLRPPLNP 179 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 155 YIGPPTPFPRFIPPNAYRLRPPLNP 179 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 158 YIGPPTPFPRFIPPNAYRFRPPLNP 182 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 150 YIGPPTPFPRFIPPNAYRFRPPLNP 174 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 160 YIGPPTPFPRFIPPNAYRFRPPLNP 184 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 369 YIGPPTPFPRFIPPNAYRFRPPLNP 393 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 375 YIGPPTPFPRFIPPNAYRFRPPLNP 399 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 395 YIGPPTPFPRFIPPNAYRFRPPLNP 419 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 365 YIGPPTPFPRFIPPNAYRFRPPLNP 389 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 376 YIGPPTPFPRFIPPNAYRFRPPLNP 400 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 376 YIGPPTPFPRFIPPNAYRFRPPLNP 400 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 365 YIGPPTPFPRFIPPNAYRFRPPLNP 389 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 383 YIGPPTPFPRFIPPNAYRLRPPLNP 407 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 387 YIGPPTPFPRFIPPNAYRFRPPQNP 411 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 397 YIGPPTPFPRFIPPNAYRFRPPLNP 421 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 566 RSSAVADASSRPPGASGARVTVACG 640 ++ V+ RP G +G R ++ CG Sbjct: 215 KNGIVSPQEERPKGINGRRASLFCG 239 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -2 Query: 576 AELRCGFTLSFVAEHTVEEKPGRGVSLYDPVGWF 475 A++R FT + + ++ E P + ++L + WF Sbjct: 501 ADVRPPFTYASLIRQSIIESPDKQLTLNEIYNWF 534 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 566 RSSAVADASSRPPGASGARVTVACG 640 ++ V+ RP G +G R ++ CG Sbjct: 210 KNGIVSPQEERPKGINGRRASLFCG 234 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 144 IGPSTPFPRFIPPNAYRLRPPLNP 167 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 144 IGPSTPFPRFIPPNAYRLRPPLNP 167 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 144 IGPSTPFPRFIPPNAYRLRPPLNP 167 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 144 IGPSTPFPRFIPPNAYRLRPPLNP 167 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 144 IGPSTPFPRFIPPNAYRLRPPLNP 167 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 155 IGPSTPFPRFIPPNAYRFRPPLNP 178 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 155 IGPSTPFPRFIPPNAYRFRPPLNP 178 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 155 IGPSTPFPRFIPPNAYRFRPPLNP 178 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 155 IGPSTPFPRFIPPNAYRFRPPLNP 178 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 147 IGPSTPFPRFIPPNAYRFRPPLNP 170 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 153 IGPSTPFPRFIPPNAYRFRPPLNP 176 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 144 YIGPPTPFPRFIPPNAYRFHPPLNP 168 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 144 YIGPPTPFPRFIPPNAYRFHPPLNP 168 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 144 YIGPPTPFPRFIPPNAYRFHPPLNP 168 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 144 YIGPPTPFPRFIPPNAYRFHPPLNP 168 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 150 IGPSTPFPRFIPPNAYRFRPPLNP 173 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 150 IGPSTPFPRFIPPNAYRFRPPLNP 173 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 150 IGPSTPFPRFIPPNAYRFRPPLNP 173 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 150 IGPSTPFPRFIPPNAYRFRPPLNP 173 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 148 YIGPPTPFPRFIPPNAYRFHPPLNP 172 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 153 YIGPPTPFPRFIPPNAYRFHPPLNP 177 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 153 YIGPPTPFPRFIPPNAYRFHPPLNP 177 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 153 YIGPPTPFPRFIPPNAYRFHPPLNP 177 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 229 WVGPKIPWARGLLPTPCRSLSPTNP 155 ++GP P+ R + P R P NP Sbjct: 369 YIGPPTPFPRFIPPNVYRFRPPLNP 393 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 395 IGPSTPFPRFIPPNAYRFRPPLNP 418 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 151 IGPPTPFPRFIPPNAYRFRPPLNP 174 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 376 IGPPTPFPRFIPPNAYRFRPPLNP 399 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 148 IGPLTPFPRFIPPNAYRFRPPLNP 171 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P R P NP Sbjct: 389 IGPLTPFPRFIPPNAYRFRPPLNP 412 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P + P NP Sbjct: 153 IGPSTPFPRFIPPNAYKFRPPLNP 176 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P + P NP Sbjct: 153 IGPSTPFPRFIPPNAYKFRPPLNP 176 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P + P NP Sbjct: 153 IGPSTPFPRFIPPNAYKFRPPLNP 176 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P + P NP Sbjct: 153 IGPSTPFPRFIPPNAYKFRPPLNP 176 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P + P NP Sbjct: 153 IGPSTPFPRFIPPNAYKFRPPLNP 176 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P + P NP Sbjct: 153 IGPSTPFPRFIPPNAYKFRPPLNP 176 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -1 Query: 226 VGPKIPWARGLLPTPCRSLSPTNP 155 +GP P+ R + P + P NP Sbjct: 156 IGPSTPFPRFIPPNAYKFRPPLNP 179 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.4 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 324 NQTCGATPRTPDRRXXEAIVDDQRRRSPRYGGLARP 431 +Q C + RTP R + +D+ R P G RP Sbjct: 1330 DQLCRNSRRTPVPRLAQDSSEDESYRGPSASG-GRP 1364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,533 Number of Sequences: 438 Number of extensions: 5998 Number of successful extensions: 89 Number of sequences better than 10.0: 87 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -