BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0830 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15940.1 68418.m01864 short-chain dehydrogenase/reductase (SD... 28 6.8 At1g27340.1 68414.m03330 F-box family protein contains Pfam PF00... 28 6.8 >At5g15940.1 68418.m01864 short-chain dehydrogenase/reductase (SDR) family protein similar to forever young oxidoreductase GI:18138083 from [Lycopersicon esculentum] Length = 346 Score = 27.9 bits (59), Expect = 6.8 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = -1 Query: 482 PCT*FSYYSVLCLLFCVYXXXXXXXXXXXIAYIGV*AHSPPDVKW-LLEPIDIYNVNAPL 306 PC YS LCLL Y +++ V A P VK ++ + Y + + + Sbjct: 212 PCARIYEYSKLCLLLFSYELHRQLRLIDDSSHVSVIAADPGFVKTNIMRELPCY-ITSMV 270 Query: 305 ALGYKF*GL 279 LG+K GL Sbjct: 271 FLGFKILGL 279 >At1g27340.1 68414.m03330 F-box family protein contains Pfam PF00646: F-box domain; similar to fim protein; similar to ESTs gb|T42445, gb|T76780, gb|AA650733, and emb|Z17748 Length = 467 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -3 Query: 678 LYVLLNNIWYSSLTIFANVYVPLL*NLRLYLFVILAVLHTLIT 550 +Y L+N+W TI +N+ +P+L N + I + L+ ++T Sbjct: 277 VYDSLSNVWTKRGTIPSNIKLPVLLNFKSQPVAIHSTLYFMLT 319 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,131,881 Number of Sequences: 28952 Number of extensions: 274355 Number of successful extensions: 458 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -